SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383458515|ref|YP_005372504.1| from Corallococcus coralloides DSM 2259

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383458515|ref|YP_005372504.1|
Domain Number 1 Region: 376-611,680-719
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.58e-59
Family Type II chitinase 0.0009
Further Details:      
 
Domain Number 2 Region: 192-280
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000381
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 3 Region: 286-378
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000295
Family C1 set domains (antibody constant domain-like) 0.07
Further Details:      
 
Weak hits

Sequence:  gi|383458515|ref|YP_005372504.1|
Domain Number - Region: 603-656
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0159
Family Chitinase insertion domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383458515|ref|YP_005372504.1|
Sequence length 721
Comment putative chitinase [Corallococcus coralloides DSM 2259]
Sequence
MRRQLIGFLVALGAMHTGCGGAPDFTSTAGDDDSLGMSGDALASATTMFDDALGSGWQDW
SWATHSLSATRPVYAGTRSISATFKPWTGLYFHHAGVPTTGYGFVELQVNPGATANPAIA
LYASVGGVAKSPVALNPTCAGGTLKANAWTLCRMPLATLGAANTTLDGLVVMENAGRTLA
TMYFDNVRLAASTTAPSAPTALKATGSATDVALTWGTVTGATGYHVYRATSQTGTYTRLT
SSALTAASYKDTSAAVNTTYWYAVTALNAAGESAKSTAVSGKRTSTTGVSVSVTPVSVTL
SRGGVQTFTALVTGNTNTAVTWSVQEGATGGTITTSGTYTAPQTAGTYHVVATSKADTTK
KATADVVVTGPVGNTNKWVSGYYTGWNADDYPPEKVDFSALTHIMVGRVTPNTDGTVDAI
FDNSNGSAMAKTLSTRAHAAGRKAIIMVGGAGEHANWVGAASSANREKFVQNLLKTMDDH
GYDGLDIDWEPVEEVDKPNLLALVQRLRQVRPNMLLTFPIGWVNNNFASDASLKWYPQLA
QYLDQVNVMSYEMIGVWDGWDSWFTSALKGESGTHPTSVESSLKAWVAAGIPKEKLGMGI
PFYGLAWRNISGPRQPFTNWSDYVGGDNSFTYKKILALSKTGTLQWDAAAQANYVTFNTP
VEDGTVRWITYDGPEAIQAKGQYAKANGYGGTIIWTINQGCTDPATGANPLLTEVKKAFL
Q
Download sequence
Identical sequences H8MUM6
gi|383458515|ref|YP_005372504.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]