SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383454422|ref|YP_005368411.1| from Corallococcus coralloides DSM 2259

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383454422|ref|YP_005368411.1|
Domain Number 1 Region: 32-121
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.000000000403
Family UbiE/COQ5-like 0.036
Further Details:      
 
Domain Number 2 Region: 1511-1734
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000948
Family Tropomyosin 0.00084
Further Details:      
 
Domain Number 3 Region: 1282-1494
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000915
Family Tropomyosin 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383454422|ref|YP_005368411.1|
Sequence length 2223
Comment hypothetical protein COCOR_02424 [Corallococcus coralloides DSM 2259]
Sequence
MGPSELLPRYIFAESLFARRRVLEVDAVASTGGESARFLVERGARTVVACDADVAAVEAA
QKAHAHPQVRYRANVYDDLEAGSFDLVLVTDLAPYVRAPELLAELARLVARQGFLVGGLR
NIAGLALPQLLEPEETVPPTYGQLLDALTAHFPHVEVATQSPVLGYQLAFERGEGLQVDG
SLVRHSEAAYFVVMAGLEPARVVDPTWVQLPPEPLAFTRGKLDEVAARAKTWEERAGRLK
EAVSKLRAEIGDREAEVVALKPALEGARHDMARLTAQLEQARGTVESARERDDLSSRLRR
RELELQVATERIADADRRLTAQRLEVEAAQRAQADAGVQVLAAQETLRLERARREETAAT
LDEARERLTQAYTEVRALQDELGSLRIDRERDRLAAERAQDSAEDRRRQAEAARERELRI
AEQYSTALAAVEHLKADLARAQESARTAGDAVPVKDAELARARRELAEAQQRMHSAEGAR
KDAEARLAEREALQRGLETELASARAAEERLRQELEGRAQSESAARALAARLEEELHAAG
LRLESLEAEQKRVESAQHVAGQRLAAAETERVRVEAALVQAIDAERGQAQARLDEALAQA
RAEADERVTNALAAAHADADSRQERALAEAREQEEARLAKALEDERAYAELALTEAREQA
EARLAQALEEARSDAAARLAQSLEEARSDADARVERALADAREAAQALEANRSDADTRVE
RALAEAREAARADADARVERAVADAAQALEAARADADARVERAVADAAQALEAARADADA
RVERALAEARADADARMAKALADAAAERAAALAEAEHRREQALTEVRATASAQRSRQLAD
VEARTEQALAEARAEAEAERAQALAEARAESEAERVRQLEEAEVRAARMLAEVRAEVEAR
AATALADARAESSGQTEQVLANVRAEAEARLAAAEARAAEALEAAVEQTRSEARDTLARE
VWEHGARLAESNQAREAAEARNTELEATLRSLRQELTDSEALAALIQEDLAREQKARASV
QAELDAAREALSNEQERAARWEALLADTQAQLLSEREQQARAQVALANLQESLDAERALR
SKLEGSESSWNEAQSALEADRLRLDAALGVARTVLEEERSQRARLEASLAQLQQDSASAL
EEERARAEASRVSAQEARAQLETDLSAARAARLSTEAAFEQTRQTLSEVQASFAEAQRTN
EAALLELRQSHAASADEVRGYVRELEEARTALAEAKQSQSALDATVRELRAELTEARRSE
VEALSSLDDARTQEARDRESRAKDETALRSELETLRAESAAQRERLTEAEQARAAVQARL
AEVEARLATETTRGTTLEQALAEAESRLAAVSSQRAELEQALADAKARHAADAARLTSLE
QSLADAESQQTTETERHASLARTLAEAEARLAAESTRRAELEAALAEAEARQAAESTRRA
ELEAALAEAEARQTAESTRRAELEAALAEAEARQIAESTRRAELEASLSEVDVRQAAEST
RRSELEATIASAESTIAAESARRSELEASLKDAEARLSTLEQALADAETRAASETSRRVG
LEASLTEVEFRLAAETSNLSALEDSLAQAEARLAEGSQSQDAARESEARAARLTESLTAR
EQELREASALRVSMEAQLEGALSRTERQQQDLDELRAQLGLKEQELTALRAETARLGAAH
QELMRLGSELQRAHAALHERSQQVGRLEAELVDASDRLAATREHAEVLVVQLETARRFAG
KATNLESALEGLRAELETARAEAARLTETVQTGNERTATLEAQLADLTTRAERERTDLEA
RLAEASAQAGTEQAELELRLTEALTSAGTDKATLELRLNEALARASMEKSELETRFNERL
ASTEAEKAELETRLNELLANAGTEKSELETRLNELLANAGTEKAELETRLNELLANAGTE
KAELETRLAETLAQAGTERAELEARLAELTEQAREEKSSIEAQLADATARAAAERAELEA
RIADLTAQADSANAERDARLSEAQARASTEQAELEARLARSAEQTREALAAMEARLATAL
EDARTEQAALESRVAALTQAAADAEAHARRADSERERLQSDLTVARAARVRLEGRTNSLE
TAAADAARLLDTERAERDQLSARIREQQARLEALETERETLVQALEEAKSATPAPPEDVL
EMAAEMEVLQAHVEKMQDQLAAREAELAELRRASSAPAAPGSARRAMPALDVPASPKKVG
ERE
Download sequence
Identical sequences H8MPH7
gi|383454422|ref|YP_005368411.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]