SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383457034|ref|YP_005371023.1| from Corallococcus coralloides DSM 2259

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383457034|ref|YP_005371023.1|
Domain Number 1 Region: 3-116
Classification Level Classification E-value
Superfamily CheY-like 1.42e-16
Family CheY-related 0.0016
Further Details:      
 
Domain Number 2 Region: 544-784
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000177
Family Tropomyosin 0.0036
Further Details:      
 
Domain Number 3 Region: 772-982
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000589
Family Tropomyosin 0.0036
Further Details:      
 
Weak hits

Sequence:  gi|383457034|ref|YP_005371023.1|
Domain Number - Region: 976-1065
Classification Level Classification E-value
Superfamily Prefoldin 0.0314
Family Prefoldin 0.023
Further Details:      
 
Domain Number - Region: 209-355
Classification Level Classification E-value
Superfamily Tropomyosin 0.0324
Family Tropomyosin 0.017
Further Details:      
 
Domain Number - Region: 334-555
Classification Level Classification E-value
Superfamily Tropomyosin 0.0785
Family Tropomyosin 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383457034|ref|YP_005371023.1|
Sequence length 1531
Comment adventurous gliding motility protein AglZ [Corallococcus coralloides DSM 2259]
Sequence
MERRVLIVESQNDFALSMASVLKSAGYNTAMATTASDAQRELEKRRPDLVVVRAELPDQS
GFALCGQIKKGKWGQNLKVLLLSSDSGVEGLNKHRETPAAADGYLVIPFEMGELASMSAG
IVPPGSDESDADLDAALSGAPREAPPPMPGVRTGAPPKLPKRERRSAMTDEDKAFMDRAF
SSIADRKAELLAESRQLKRPPPRRELMGTPEGKIQILRDELKTREAQLARLSEIWSVRER
ELLSVEDRLHEKDVELQGLKMQVDDLLRRFNDAQQSIVQKEREHGATVDDLLLQKFSSEK
DLIEVVASKEKDINVLRKEVNLRDEELSRRGADLESWRNEFDKLEKHLGVVTLEFEVKEQ
KLQDTVRANEADILQLRERGDQFESELSRTVSERDQRYAELDGELQALQERLTQTEQERD
ATVRGLEARATTAEEHASRSDAEIERLNAERAALEQRLNQQVADLESDIARVTGERDQLR
LDKDALEADLTQRVEEREAKISALDRELQETIARNENSEAELNATIQQHRERIGELEGEV
EAVKTHLEDRENELNAEIQALQQAKDALEQDLTSQLEDLRAAKDALEADLNGQIQALTEQ
LDAAQRQGEQLSARVASLEDTVAQRDGTIEGLQTDVSDRDSRIAELTGNLEATSQQLSET
QNTLSSTEATLAETRGELEATSQQLSETQGTLSNTEATLSETRGELEATSQQLSETQTRL
AQTEETLSTTRGELEATSQTLATTEATLADTQGTLARTEATLSDTQAPSPSTEGTLAETR
GELEATSQTLSDTQARLAQTEETLSTTRGELEATSQTLSDTQATLSSTEGTLSETRGELE
ATSQTLTETQARLAQTEGTLASTQGELEATSQTLATTESTLAQTQDTLARTEATLADTQA
TLSSTEGTLAETRGELEATSQTLTQTQETLESTRADLAKVTQHRDELDAELHETRDLLQE
TNGLLARTTEERDARIADLQALNAAKDALEQDLTGQIGQLRADLSETQGLYDAERTAHAA
LAEETTARINALTGERDNLTAELNATSQQLADTQGQLASTQDALAREEQAHAQSRQAAAS
MQAELTRQLTEAQANGEDLAEQLIVTKHELGTRVSEVTQLSSTLAQTEDARHHLEDRLQT
LTHESQRREELLQNEVDTKGKELSDTLRKLTHVTQEKMRQAEVLNREVTTRTEQVKQLEG
QLEHQASEAKKQADALNQQLANVSGELDGARKAIADRDGQLQQAANQQKKLTSERDGLAG
QLQQAQAQAQQQAQQAQAAAAEAKKQSDDLAAKLAKADQRIAQLSQEAQKFAADTEAKLK
DAQAQLQARTKKAQDLELALENAQSTRARAEKDLNARVAAAETKANEAAARLATAQKERK
DLEARQAKELEDLNAKQKAELERREAIKAQEVARLQTSVQEKSKALKVAELELARYKTKA
PAAAAPAAKAGAKASEEEHLAATVQANPVIPAAAKPPAKAAGKPAAKKAAAAPTPVPVDE
EAPERTMVMQLPTAPEAGEDDWTALVDELDK
Download sequence
Identical sequences H8MR86
gi|383457034|ref|YP_005371023.1| WP_014397860.1.7229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]