SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383457277|ref|YP_005371266.1| from Corallococcus coralloides DSM 2259

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383457277|ref|YP_005371266.1|
Domain Number 1 Region: 292-588
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 1.48e-38
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00097
Further Details:      
 
Domain Number 2 Region: 154-290
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 2.97e-33
Family Ferredoxin domains from multidomain proteins 0.0002
Further Details:      
 
Domain Number 3 Region: 80-152
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.85e-17
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383457277|ref|YP_005371266.1|
Sequence length 630
Comment putative NADH dehydrogenase I subunit G [Corallococcus coralloides DSM 2259]
Sequence
MSDNDTKKPTGDAQTPPKGAPTDTPAAKIGPEPSNPPAGAKLDSPPAAHSGPTGTPPPKP
AAPPAGGPPPKPQPKNPGFVTAVIDGREVVVKPGTNMIEAAKSVGSEIPYYCYHPRLSIA
ANCRICLIEASNAPKLVPACQTPMAEGQVIKTTTPKVKEQQRAVMEFLLLNHPVDCSICD
QAGECKLQDYYMKYDYKPSRLEGTKALKHKRKVLGPRVVLDQERCIICTRCVRFMNEIPK
EPQLGVFGRGSHERIDVFPGNELDSNYSLNTVDVCPVGALLSRDFRFKARSWFLSATPSV
CTGCSRGCSISADWMSQDTYRYRPRENEAINKSWMCDQGRLSYKDLNVGRVLSARVGRGL
QAPGTVQPVLTRKDAALGAAKALKPLAGSKQLAVLASPLASNEDLLAGLTFAKTVLGVTS
VFVGGRPQGKADHYLMTADKNPNRQGLALIAKGLGLSLKGFEELTPAIKAGQVKALYAVG
TEVPTDAAAFAEVLASLEVFVAQAQNESPVTAQATVLLPASAHIEDEGTFTQADGITQRF
RKAYPSKGDAVPHWKWATELTRELGGEAAAASARDVWRALSGQVSEFAEFNWDKASPPDR
EKPGINPLPSSADGRPPGYREFGAPRVRGI
Download sequence
Identical sequences H8MVW8
WP_014398103.1.7229 gi|383457277|ref|YP_005371266.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]