SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000004479 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000004479
Domain Number 1 Region: 84-179
Classification Level Classification E-value
Superfamily PDZ domain-like 4.99e-30
Family PDZ domain 0.015
Further Details:      
 
Domain Number 2 Region: 7-57
Classification Level Classification E-value
Superfamily L27 domain 1.41e-16
Family L27 domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000004479   Gene: ENSXETG00000000264   Transcript: ENSXETT00000004479
Sequence length 194
Comment pep:known scaffold:JGI_4.2:GL176470.1:7882:10022:1 gene:ENSXETG00000000264 transcript:ENSXETT00000004479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSFMFPDVHRAIELLEKLQRSGEVPPHKLHALQRVLQSDFCTAVRELSYLIFNKINLYT
QTRAPIHTYRYTRATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYISRII
PGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPRVLEEMES
RFEKMRSAKRRQQN
Download sequence
Identical sequences F6PZ81
ENSXETP00000004479 ENSXETP00000004479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]