SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000009876 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000009876
Domain Number 1 Region: 365-571
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.11e-58
Family Nucleotide and nucleoside kinases 0.0000968
Further Details:      
 
Domain Number 2 Region: 204-350
Classification Level Classification E-value
Superfamily SH3-domain 9.06e-29
Family SH3-domain 0.001
Further Details:      
 
Domain Number 3 Region: 118-220
Classification Level Classification E-value
Superfamily PDZ domain-like 8.15e-21
Family PDZ domain 0.00089
Further Details:      
 
Domain Number 4 Region: 71-122
Classification Level Classification E-value
Superfamily L27 domain 0.000000000000706
Family L27 domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000009876   Gene: ENSXETG00000004546   Transcript: ENSXETT00000009876
Sequence length 576
Comment pep:known scaffold:JGI_4.2:GL172683.1:338668:448910:1 gene:ENSXETG00000004546 transcript:ENSXETT00000009876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPSNPTGKSNMCCLYEILATLPAQLQPHVDSQEDLTFLWDMFGEKSLHSLVKIHEKLHYY
EKENPMPVIHSATALAEELAEELQSKSLNSEIRELLKLLSKPNLKALLSVHDTVAQKSYD
PVLPPMPDDIDDDEDSVKIIRLVKNREPLGATIKKDEKTGAIVVARIMRGGAADRSGLIH
VGDELREVNGISVEDKKPEEIIHILAQSQGAITFKIIPSIKEEPPNNDGKMFVKALFDYY
PNEDKAIPCKEAGLSFRKGDILQIMSQDDATWWQAKHEGDANPRAGLIPSKQFQERRFAL
RKPVVSNQPQKVPNRKSSGFRRSFRLSRKDRKTNKFMYECKKSDQYDTADVPTYEEVALY
QRKPNEKYRLVILVGPVGVGVNELKRKVLIGNSQHYGVTVPHTTRGKRSQENDGVEYIFI
SKHLFETDIHNNKFIEYGEYKNNYYGTSLDSVRSVLAKNKICLLDVQPNSLKHLRTSEFK
PFVIFIKPPTIERLRETRRNAKVISGKDERGAAKPFSDEDFEEMIQSAEAMEAQYDHFFD
TTIVNDDLSAAYNELRSTLERLEMEGFWVPVSWLHS
Download sequence
Identical sequences F7E5H0
ENSXETP00000009870 ENSXETP00000009876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]