SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000010527 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000010527
Domain Number 1 Region: 22-297
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-75
Family Protein kinases, catalytic subunit 0.00000728
Further Details:      
 
Domain Number 2 Region: 740-927
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.83e-50
Family Nucleotide and nucleoside kinases 0.0000000531
Further Details:      
 
Domain Number 3 Region: 612-730
Classification Level Classification E-value
Superfamily SH3-domain 4.99e-33
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 4 Region: 479-579
Classification Level Classification E-value
Superfamily PDZ domain-like 4.6e-21
Family PDZ domain 0.0000162
Further Details:      
 
Domain Number 5 Region: 346-398
Classification Level Classification E-value
Superfamily L27 domain 6.18e-21
Family L27 domain 0.0000634
Further Details:      
 
Domain Number 6 Region: 408-459
Classification Level Classification E-value
Superfamily L27 domain 0.0000000000000459
Family L27 domain 0.0000547
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000010527   Gene: ENSXETG00000004852   Transcript: ENSXETT00000010527
Sequence length 931
Comment pep:known scaffold:JGI_4.2:GL172671.1:771040:911913:1 gene:ENSXETG00000004852 transcript:ENSXETT00000010527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAEQEVQFHTTYRIKLMYMTIFYRGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLST
EDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEA
VASHYMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGLVA
GVGRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKY
KMNPRQWNHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQL
RKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGLLAAERAVSQVLDSLE
EIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEE
ISCYPENNDAKELKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPES
ANGDMDMENVTRVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDE
IREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHS
SINNSVSDIPTTTQTKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHN
WWQGKLENAKNGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAK
HNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTT
RPPKKDEENGKNYFFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAIL
DVEPQALKVLRTAEFAPFVVFIAAPTITPSISEDESLQRLQKESEILQRTYAHYFDLTII
NNEIDETIRHLEDAIELVCTAPQWVPVSWVY
Download sequence
Identical sequences F6UGQ3
ENSXETP00000010527 ENSXETP00000010527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]