SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000012647 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000012647
Domain Number 1 Region: 361-564
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.32e-54
Family Nucleotide and nucleoside kinases 0.0000134
Further Details:      
 
Domain Number 2 Region: 219-351
Classification Level Classification E-value
Superfamily SH3-domain 1.23e-32
Family SH3-domain 0.0014
Further Details:      
 
Domain Number 3 Region: 133-234
Classification Level Classification E-value
Superfamily PDZ domain-like 6.18e-17
Family PDZ domain 0.00093
Further Details:      
 
Domain Number 4 Region: 82-135
Classification Level Classification E-value
Superfamily L27 domain 0.00000000000153
Family L27 domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000012647   Gene: ENSXETG00000003381   Transcript: ENSXETT00000012647
Sequence length 568
Comment pep:known scaffold:JGI_4.2:GL172791.1:1142155:1163845:-1 gene:ENSXETG00000003381 transcript:ENSXETT00000012647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPVSGVSVEGVSLDSAEESEIHRKAMQRVLHGLSDLPASSDLDLIFLQGIMESPKVRK
SRYLSKAHECMEEIRLEAVRENNLQLVQEILQDMAGVRDPSGVAAELQGILQEPHFQSLL
QTHDSVASKNYETPPPSPMLDPTLSNQPVPPDAVRMVGIRKSAGEHLGVTFRVEGGELVI
ARILHGGVIDQQGLLHVGDVIREVNGREVGSDPQALQEMLREASGSVVLKILPSYQEQHP
LRQVFVKCHFSYDPSSDSLIPCKEAGLPFKAGDLLQIVNQEDPNWWQACLVKGGTAGLIP
SQLLEEKRKAFVKRDGEFTPNSSALCGSIGGKKKKRIMYVTTKNAEFDRHELLIYEEVAR
MPPFRRKTLILIGAQGVGRRSLKNKLLTSDPSRYGTTIPYTSRKRKEGEWDGQSYSFVTR
AEMEQDIKAGRYLEHGEYEGNLYGTKISSIQEVVASGKMCVLDVNPQAVKVLRTAEFVPY
VVFVGAPDFQTLKSNNLSAVEVGITNKQLTDAELLRIVEESERLQQAYGHYFDLTLVNYD
LDQTFQELQVALEKLNSEPQWVPVSWVY
Download sequence
Identical sequences F6X3V7
ENSXETP00000007334 ENSXETP00000012647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]