SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000026669 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000026669
Domain Number 1 Region: 534-565,649-723
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000667
Family Anti-sigma factor antagonist SpoIIaa 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000026669   Gene: ENSXETG00000012196   Transcript: ENSXETT00000026669
Sequence length 778
Comment pep:known scaffold:JGI_4.2:GL172681.1:3414224:3429485:1 gene:ENSXETG00000012196 transcript:ENSXETT00000026669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATGRMDIPSPGYNQYLVHRSVYNEPTFQDDNERKERVQKTVQDRIKKNCSCTSKKAYFI
VKKFFPVLDWLPKYRWKEWFVNDLISGVSTGLVGTLQGLAFALLAAVPVGYGLYSSFFPI
LTYFFLGTSKHISVGPFPVVSLMVGSVVLSIAPDEKFAILGNATGLNKTIIDTVARDAAR
IAVSGTLSFLIGIIQLALGIFQIGFIVRYLADPLVGGFTTAAAFQVFVSQFKLVLNVPTQ
NYNGVLSIIYTIRDIFMNIRLTNIADLIAGLLTFVVCVVVKEINDRYKRIFRVPIPIEVI
VTIVATGISYGVNLHAKYNAGIVATIPSGFIPPMTPDVSLFSQIGSSAFSIGIVAYAVAV
SVGKVYATKHNYEVDGNQEFIAFGISNLFGGAFSCFCATTALSRTAVQESTGGRTQIAGI
ISAGIVLIAIVALGRLLEPLQKSVLAAIVIANLKGMFWQVFDIPRLWKQNKWDSAIWVFT
CIASIFLGLDSGLLAGLLFGLATILLRVQFPSCGALGNVPGTDIYKNVKEYKNLIEPEGV
KIIRHTSGMFYGNIDGFKNAIKSIVGFDPVKVYNKRTKALRKIQKLIKKGQLRSTKNGVI
SNTGTDNEGFEPDEDVEDPEQENNGAVQTKEVEIQVDWNSELPVKISVPKVSIHSIIFDF
GQIHFIDVVAVRSLKVIFKELKRIDVEPYIAACEDGVLQKMGSCLFFDEIIKHDIFFLTV
HDAVLHIENLRKFYDGHDPLLEKISLMQESKEPLEFTTIDPTDQELDAQEGALRSLAH
Download sequence
Identical sequences A9UM38
gi|163916149|gb|AAI57509| gi|165973366|ref|NP_001107135| gi|213625627|gb|AAI71001| NP_001107135.1.99540 XP_012814661.1.99540 ENSXETP00000026669 8364.ENSXETP00000026669 ENSXETP00000026669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]