SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000026731 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000026731
Domain Number 1 Region: 522-554,636-710
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.53e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000026731   Gene: ENSXETG00000012233   Transcript: ENSXETT00000026731
Sequence length 756
Comment pep:known scaffold:JGI_4.2:GL172681.1:3461069:3477693:-1 gene:ENSXETG00000012233 transcript:ENSXETT00000026731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIETVGNQYVVSRPIYSENAFHTEHEKLHRYHKTFLDHLRVFFGSINDFLALQSITFILY
AYYQPYPLNIYSKYILYETYSQNLKDPKLEFICHTILYIIFLPVVKNVIQKCPFYVTFQG
TGILSILRPKLAFWLGSFNQCSRPPRAKKLLPYTGYYCLGTVIFDGSPKTEFPACVTLTS
KNFQLAMGLLQIGFIVIYLSDSLISGFTTAAAIHVLVSQLKFVFGLKVEPFSGPLSLFYT
LKGIFIQITDTNIADLVTSIIIMVVVFVVKEINDRFKAKIPVPIPIEVIMTVIATGVSYA
LNFKDRYKVDIVGTLEKGFQPPIAPSLSVFQDCVGDGFSIAIVGFAVAFSVAKVYSVKHD
YVINGNQELVAFGLSNIFGGCFKGFAASTALSRSAVQESTGGKTQIAGILSAIIVMIVIL
AIGFLIEPLQKSVLGALVIINLKGMLMQFNELPVLFRKDKYDMLVWIVTFLGAVLLGLDL
GLAAGVGFELLTVVFRAQFPKCSQIANVGGSNIYKNRKDYKNIYEPQGVKIFRCPSPVFF
ANIEFFKDKVIAAVGFNPLRILRKRNKALRKIRKLLSKGELQWTPKGMINTSNYNIDSDE
ELDNNHIEELDQPTYTADLPITINWNEDLPNNISVPKIDIHSLILDFGAVSFIDMSGMKG
LKGALKEFLKIEVDIYIAGIDDNLLEKLERCGFFDDEITTSIIFLSIHDAVLHILAKKDN
MANLNNFKQQEKESFANDKNNGLRNRANSVSYMIKL
Download sequence
Identical sequences F6WBF8
ENSXETP00000026731 ENSXETP00000026731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]