SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000026776 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000026776
Domain Number 1 Region: 518-550,632-706
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000165
Family Anti-sigma factor antagonist SpoIIaa 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000026776   Gene: ENSXETG00000034012   Transcript: ENSXETT00000026776
Sequence length 755
Comment pep:known scaffold:JGI_4.2:GL172681.1:3511535:3541281:-1 gene:ENSXETG00000034012 transcript:ENSXETT00000026776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEHSGNNYLVDRPIFSENAFAANHPKLSRNHKTFLDHLKECFRCSPQKAKQILFTFFPI
LSWLPAYNFKQWLVGDIISGISTGTVAVLQGLAFALLVNISPSYGLYSAFFPILTYFILG
TSRHISVGPFPVLSLMVGTAVLKIVPEGSNGTTLFANNMTIEEQRVFVAGTITALAGIFQ
LALGLLQVGFIVIYLSDPLISGFTTGAAVLVGVSQIKFILGLKISNFSGPLSMFYTLEDI
FKKITLTNICDLVTSIIIMVVVFVVKEVNDRFKAKIPIPIPIELIMTVIATGISYGCDFA
GRYGIQIIGELKQGYEPPITPSVEVFQELVTDGFAIGIVAFAVGYSVAKVYALKHDYLIN
GSQELVAFGISNIFCGCFRGFAVSTSLSRSAVQESTGGKSQIAGVLSALIAMIVTLAVGF
LLKTLPKSVLGALVLINLKGMLMQFSEIRNLWRKDKYDCSVWIVTFIAVVILGLDYGLAA
GVGYELLTVVFRTQFPKFTVIANIGRSDIYKNKKDYTEIYEPEGTLIFKCPSPIFFANAG
FFKEKVSAAVGFNPLRILRKRNKALRKISALLKEGVLHVTPKGLVCTSYEYNASDDELDN
NRVEELYNPIHPNDLPFHIDWNADLPYNIVVPKVDIHSLILDFGAVSFIDVSGMKSLKST
IKEYIRIDVDVYIANIDSDLLYKLENCEFFDDEIQTSIFFLTVHDAVLHSIAKKGMKYPY
DIQPAKEVNYYTYINGYTDENLRNRAITMPNETKF
Download sequence
Identical sequences F6VK35
ENSXETP00000026776 ENSXETP00000026776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]