SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000036758 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000036758
Domain Number 1 Region: 163-405
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.97e-88
Family Eukaryotic proteases 0.0000000881
Further Details:      
 
Domain Number 2 Region: 54-156
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000000288
Family Hepsin, N-terminal domain 0.0000396
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000036758   Gene: ENSXETG00000016870   Transcript: ENSXETT00000036758
Sequence length 416
Comment pep:known scaffold:JGI_4.2:GL173363.1:402879:422882:1 gene:ENSXETG00000016870 transcript:ENSXETT00000036758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEKEGMGKGCRWTSQRILGVTLCVLISLAGIGVIAWAVVTYVLKNENQNLYIVQVNLPD
HRLSVYDEKEKVWRLVCSSFSNPEVATLSCEEMGFIRSVSHQELRVETAGTNGTSGYYCV
HESQINSAKRLLDILTVCECPSGRFLSVQCQDCGRRKLAVDRIVGGQDATLGRWPWQVSL
RYDGAHLCGGSLISSEWVLTAAHCFPERNRIVSQWRVFAGAVSQLSPRGKLLGVKGIIYH
SGYLPFLNPDSEENSNDIALVHLASPVTLSEYIQPVCLPALGQQIIDGKICTVSGWGNLQ
YYGQQSEILQEASVPIISSSVCNQPEYYMNQITGKMFCAGYAEGGIDACQGDSGGPFVCE
DTLSRSSRWRLCGIVSWGIGCAMPNKPGVYAKVDQYQYWIYRAMKTKSDVAGITEL
Download sequence
Identical sequences F6U6G0
ENSXETP00000036757 ENSXETP00000036758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]