SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000060306 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000060306
Domain Number 1 Region: 400-602
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.65e-57
Family Nucleotide and nucleoside kinases 0.00013
Further Details:      
 
Domain Number 2 Region: 193-302
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-27
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 3 Region: 109-211
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000105
Family PDZ domain 0.0045
Further Details:      
 
Domain Number 4 Region: 61-111
Classification Level Classification E-value
Superfamily L27 domain 0.00000000000161
Family L27 domain 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000060306
Domain Number - Region: 19-46
Classification Level Classification E-value
Superfamily L27 domain 0.0324
Family L27 domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000060306   Gene: ENSXETG00000031296   Transcript: ENSXETT00000061410
Sequence length 609
Comment pep:known scaffold:JGI_4.2:GL172854.1:30440:52550:1 gene:ENSXETG00000031296 transcript:ENSXETT00000061410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLSQVLTMVLEELGLYYHQDVNGIGVLYNLLQAPWLQSLLKVHSCLQQYIQQRPQPVLPK
ACILSNEVVGVLRETTSSADLRELKRLLQGPHFKALLSAHDMVAQADFEPVLPPLPDNIP
DNEEAMRIVCLVKNKQPLSVSLEKKSLNSMLLSARVIHGGLADRSGLLYAGDKLVEVNGV
LVDGLEPEQVIQILARSEGTIVFKLSPVNDRYISSHTMLYVRAMADYWPQQDPAIPCADA
GLPFQRGEILQIVDQNDSLWWQARKASDLGRCAGLIPSNHLLKRKQREFWWSQPFMSHSC
IKASQSVSTIGEEEDMKIEEKFVEADEETFESAEFQVVSEELKGGNQSFNLTGFRRSMRL
CRRKTLINHMSCYSRCPSNCYHTVAAPYEEVVRYQRRPCDRHRLIVLLGPSGVGVNEMRK
QLIDLNPSMFKSPVPHTTRQKKTYEENGREYFFVSKEAFESMVYSHGFLEYGEYNGHMYG
TSVEAVKAVLDAGMICIIDLEPQCITGVRTHELKPYIIFIKPPSRNCMRYTRKNASIFTD
YYVNMKFKEEDFQEIEESAKKMEVQFGQFFDQVVVNDNLESATVQLMSILRCAQDEPQWI
PASWICLDS
Download sequence
Identical sequences F6XP61
ENSXETP00000060306 ENSXETP00000060306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]