SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000060376 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000060376
Domain Number 1 Region: 470-604
Classification Level Classification E-value
Superfamily EF-hand 0.0000000867
Family Calmodulin-like 0.029
Further Details:      
 
Domain Number 2 Region: 300-350,388-512
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000777
Family Voltage-gated potassium channels 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000060376   Gene: ENSXETG00000030335   Transcript: ENSXETT00000063389
Sequence length 735
Comment pep:known scaffold:JGI_4.2:GL172880.1:523553:543403:-1 gene:ENSXETG00000030335 transcript:ENSXETT00000063389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRHPFSLQSQREAWGEMIVNNLTGLWGTTLTENTAENRELYIKTTLRELLVYIVFLVDI
CLLTYGMTSTNTYYYTNVMSKLFLDTQSDSGVTFKAISNMDDFWSYLQGPMLDGLYWTKW
YNNVSLTDNTNSLIYYENLLLGVPRMRQLKVKNNSCMVYKDFKDEIVGCFDVYSKDKEDT
SQFGLINGTAWTYYTEEELGGSSYWGKITTYSGGGYYIDLELTKRDSLRQLQTLKSNLWL
DRGTRAVFVDFSVYNANINLFCVLRLVVEFPATGGAIPSWQIRTVKLIRYVSGWDYFIIG
CEIVFCIFIFYYVVEEILELRIHKFRYFTSIWNILDVIVILLSLVAIGFHIFRTMEVNRL
MGTLLKNPTIYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCA
KDILGFAIMFFIVFFAYAQLGYLLFGTQVENFSTFVKCIFTQFRIILGDFDYDAIDNANR
VLGPIYFVTYVFFVFFVLLNMFLAIINDTYSEVKEELSNQKNELQFSDILKQGYKKTLLK
LKLKKERISDVQKALQNGNKELKFEEFKNSLREMGHDDHEISAAFSNFDQDGNRILDEEE
QMRMKQILEERRVALNAEIENLGRSYRNKRLEEEVNLDDIKNDISSKGSWVSQDEFKIFL
KRLQQLEFSISGIMRKIESVEMKLESMETNRMKQTNIADSKQNNIVKEKQFSQEEILHRN
LGQLVKEEKEGWESE
Download sequence
Identical sequences F6W4D9
ENSXETP00000060376 ENSXETP00000060376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]