SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000061089 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000061089
Domain Number 1 Region: 101-195
Classification Level Classification E-value
Superfamily PDZ domain-like 3.02e-30
Family PDZ domain 0.011
Further Details:      
 
Domain Number 2 Region: 22-76
Classification Level Classification E-value
Superfamily L27 domain 1.1e-23
Family L27 domain 0.0000671
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000061089   Gene: ENSXETG00000034255   Transcript: ENSXETT00000062020
Sequence length 220
Comment pep:known scaffold:JGI_4.2:GL172742.1:1061530:1074361:-1 gene:ENSXETG00000034255 transcript:ENSXETT00000062020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PWGTPGHVTVAVKMAALPEPLGLERDVCRAIELLERLQRSGEVPPQKLQALQRVLQSKFC
SAVREVYEQLYDTLDITGSAEIRAHATAKATVAAFAASEGHAHPRVVELPKTDEGLGFNI
MGGKEQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVEGEQHEKAVELLKAAQGTV
KLVVRYTPKVLEEMEARFEKMRTARRRQQQNSYTSLESRG
Download sequence
Identical sequences F6X360
ENSXETP00000061089 ENSXETP00000061089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]