SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000061109 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000061109
Domain Number 1 Region: 484-679
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.95e-59
Family Nucleotide and nucleoside kinases 0.00011
Further Details:      
 
Domain Number 2 Region: 347-470
Classification Level Classification E-value
Superfamily SH3-domain 6.04e-29
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 248-350
Classification Level Classification E-value
Superfamily PDZ domain-like 8.15e-19
Family PDZ domain 0.0000598
Further Details:      
 
Domain Number 4 Region: 131-185
Classification Level Classification E-value
Superfamily L27 domain 1.12e-18
Family L27 domain 0.0001
Further Details:      
 
Domain Number 5 Region: 193-244
Classification Level Classification E-value
Superfamily L27 domain 0.00000000000636
Family L27 domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000061109   Gene: ENSXETG00000011220   Transcript: ENSXETT00000063008
Sequence length 683
Comment pep:known scaffold:JGI_4.2:GL172909.1:737306:756431:-1 gene:ENSXETG00000011220 transcript:ENSXETT00000063008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVMTTSHVNGHVTEDSDSDKQSSDLASQEEPPKHREMAVDCPGDLGTRAMPIRRSAQLER
IRQQQEDMRRRREEEGKKQDLDVNSSMRLKKLAQIFPKTGIDNPIFDTDESLVFSPYGTQ
LLPPPPACDYKIEDLISSLKDIQHTLVDSQSQEDISVLLQLAQNVDFQNAFKIHNAVAVH
MNKTSPPYPLVPNAQDLTQEVQQVLKSSHQKEGQELSALLNTPHIQALLLAHDKVAEQEM
MPEPASDDYFYENIGLYGDETVKIVRIEKARDIPLGATVRNDGDSVIISRIVKGGAAEKS
GLLHEGDEILQINGMEIRGKDVNEVFELLADMHGNLSFLLIPGQQSKPPPSKETVVHVKA
HFDYDPSDDPYVPCRELGLSFQKGDILHVISQEDPNWWQAYRDGDEDNQPLAGLVPGKSF
QQQREAMKQTIEEDKEPEKSGKLWCAKKNKKKRKKVLYNANKNDDYDNEEILTYEEMSLY
HQPANRKRPIILIGPQSCGQNELRQRLMTNEPERFAAAVPHTTRSRRENELAGRDYHFVS
RQTFDADISAGKFIEFGEFEKNLYGTSIDSVRQVINSSKICLLCLHTQSLKMLRNSDLKP
YIIFIAPPSQERLRALLAKEGRNPKPEELREIIEKAREMEQNNGHFFDTAIVNTDLDKAY
QELLRLINKLDTEPQWVPSSWLR
Download sequence
Identical sequences F6TGP7
ENSXETP00000061109 ENSXETP00000024508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]