SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000063216 from Xenopus tropicalis 69_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000063216
Domain Number 1 Region: 83-177
Classification Level Classification E-value
Superfamily PDZ domain-like 1.01e-29
Family PDZ domain 0.01
Further Details:      
 
Domain Number 2 Region: 8-60
Classification Level Classification E-value
Superfamily L27 domain 4.71e-19
Family L27 domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000063216   Gene: ENSXETG00000014525   Transcript: ENSXETT00000063115
Sequence length 204
Comment pep:known scaffold:JGI_4.2:GL172641.1:1922028:1979435:-1 gene:ENSXETG00000014525 transcript:ENSXETT00000063115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CVFLFNPTDVSRAIELLEKLETSGELPVQKLQSLKKVLQSEFCTAIREVYQYMHETIPVN
GCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIP
GGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLDEMEAR
FEKLRTARRQQNHMSSYENVEIRE
Download sequence
Identical sequences F7BCL8
ENSXETP00000031782 ENSXETP00000063216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]