SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148228297|ref|NP_001080608| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148228297|ref|NP_001080608|
Domain Number 1 Region: 2-110
Classification Level Classification E-value
Superfamily HSP20-like chaperones 4.54e-37
Family Co-chaperone p23-like 0.00000321
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148228297|ref|NP_001080608|
Sequence length 160
Comment prostaglandin-E synthase 3 [Xenopus laevis]
Sequence
MQPASAKWYDRRDYVFLEFCVEDSKNVKTDFDKNKLTFSCLGGADSVKYLNEVELFQSID
PNASKHKRTDRSVLCCLRKGEPGKSWPRLTKEKAKLNWLSVDFNNWKDWEDDSDEDMSNF
DHFSEMMNNMGGDEDVDLPEVDGADDDSPDSDDEKMPDLE
Download sequence
Identical sequences Q7ZXX8
gi|148228297|ref|NP_001080608| gi|28422407|gb|AAH44075| NP_001080608.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]