SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|28175418|gb|AAH45132| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|28175418|gb|AAH45132|
Domain Number - Region: 172-205
Classification Level Classification E-value
Superfamily DNA primase core 0.0889
Family DNA primase DnaG catalytic core 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|28175418|gb|AAH45132|
Sequence length 483
Comment Limr-pending-prov protein [Xenopus laevis]
Sequence
MEVNQDVSVREQIFHDWVRECIICSLLFSTLYLLSYIVITKFKKHADFATVDVEDAAVNR
IALWMCTFTLAVSVGAVLLLPFSIISNEVLLSVPHNYYIQWLNGSLIHGLWNLVFLFSNL
SLVFLMPFAYLFTEAEGFAGSKKGVMSRVYETTVVLLLLTLLVFGIVWVASAIFDDDSAG
RESLYDLWEYYLPYLYSGISLFGVLLLLLCTPFGLSRMFSVTGNLLVKPRLLENLEEHLS
CTAFEEAAISRKISTKASCWLNLNMEALQKRLLAIQSHRITLEMRRRASPWQRNLVYPLA
MLLLLALTGITVLIVCVNVLELLIDEAAMPKGIQGSQLGKVSFSVFGSFGAAVQVILIFY
LMASSVVGFYSSPLFIQLLPQKQNTPMTKIIGNCVSLLILSSALPVFSRTLGITRFDLLG
DFGRFNWLGNFYLILLYNMMFAGLATLCLVKKFTWAVQAELIRAFGLDRLPLSVKKIRSQ
GKA
Download sequence
Identical sequences Q7ZX75
NP_001080737.1.7800 gi|148230723|ref|NP_001080737| gi|28175418|gb|AAH45132| gi|82176529|sp|Q7ZX75|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]