SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|46250208|gb|AAH68751| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46250208|gb|AAH68751|
Domain Number 1 Region: 413-640
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.75e-27
Family RecA protein-like (ATPase-domain) 0.011
Further Details:      
 
Domain Number 2 Region: 203-352
Classification Level Classification E-value
Superfamily DNA primase core 0.00000445
Family Primase fragment of primase-helicase protein 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|46250208|gb|AAH68751|
Sequence length 679
Comment MGC81247 protein [Xenopus laevis]
Sequence
MLRLWVKRVQAVVIQQLIPARGYLLTTCLRKQADLKLARSPRKSIHVPGEPIRRHFKKGL
LTALDHGFLQPVTMTEIRQYLRSKNVSFHDGYSCLHVPSPFTPEQDTCLFIDKTTGRFLC
KATLLEGSWEDFQDSMELLHKEGCSHLSPEILAGYLVDSDSDSAEDQLKDSEVRRIWDRA
VWFSDLGEEESHQIKAMFNITKIANNTLKKFGVKCFQPTKSLVFPWYNPRDSSLNGLKLL
SAECNKQKVHYVETTYPRPARYYNLFGLCVSGKKETEVVITSREVDCLAIHQSTGVTTIA
LPRGASCLPPVLLPYLEQFKRIVLWLGDDLRSWEASKLFARKLNMKRCSLIRPGDKQPSP
LHAFNDGLNIGKILKASLPASHKSIISFRQLREEVFGQLENADQVAGVKWNRFPELNKLL
KGHRRGELTVFTGPTGSGKTTFISEYALDLCIQGINTLWGSFELNNVRLAKIMLTQFALQ
RLEEQLDKYDEWADKFEDLPLCFMTFHGQQNIKAVMDTMQHAVYMYDITHVIIDNLQFMM
GQENIYSDRFAAQDYMVGAFRKFATVNNCHVTVVIHPRKEDDDKELQTSSIFGSAKASQE
ADNVLILQDRKLVTGQGKRHLQVAKNRFDGEVGVFSLEFNKPCLSFASSKGKQKFKKLNK
DAETPNSKSSEETPAKNKK
Download sequence
Identical sequences Q6NU50
NP_001084540.1.7800 gi|147907413|ref|NP_001084540| gi|46250208|gb|AAH68751|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]