SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|139635|sp|P19009| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|139635|sp|P19009|
Domain Number 1 Region: 24-71
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000000149
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|139635|sp|P19009|
Sequence length 71
Comment RecName: Full=Vitellogenin-A1; Short=VTG A1; Flags: Precursor
Sequence
MRGIILALLLAIAGSERTQIEPVFSESKTSVYNYEAVILNGFPESGLSRAGIKINCKVEI
SAYAQRSYFLK
Download sequence
Identical sequences P19009
gi|139635|sp|P19009| gi|64501|gb|CAA25615|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]