SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|139640|sp|P19011| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|139640|sp|P19011|
Domain Number 1 Region: 24-71
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000000000129
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|139640|sp|P19011|
Sequence length 71
Comment RecName: Full=Vitellogenin-B2; Short=VTG B2; Flags: Precursor
Sequence
MRGIILALLLALAGCEKSQYEPFFSESKTYVYNYEGIILNGIPENGLARSGIKLNCKVEL
SGYAQRSYMLK
Download sequence
Identical sequences P19011
gi|139640|sp|P19011| gi|64561|gb|CAA25617|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]