SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229892283|ref|NP_001153154| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229892283|ref|NP_001153154|
Domain Number 1 Region: 417-531,652-798
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.08e-66
Family Phosphate binding protein-like 0.00000000181
Further Details:      
 
Domain Number 2 Region: 23-394
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.33e-56
Family L-arabinose binding protein-like 0.0082
Further Details:      
 
Domain Number 3 Region: 555-649
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000994
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229892283|ref|NP_001153154|
Sequence length 887
Comment glutamate receptor, ionotrophic, AMPA 3 [Xenopus laevis]
Sequence
MGQNEVQTVFLLLLSIVGESRGGFPNTINIGGLFMRNTIQEHSAFLFAVQLHNTNQNNTE
RPFQLFHHVDHLDSSNSFSVTNAFCSQFSRGVYAIFGFYDQMSMNTLTSFCGALHTSFIT
SSFPTDADVQFVIQMRPPLKGAILTLLNEYDWQKFVYLYDTERGFSILQAIMEAAVQNNW
QVTARSVGNVKDVQEFKRIIEEMDRRQEKRFVIGCEVERINTILEQVVILGKHTRGYHYM
LANLGFTGIALERVMHGGANVTGFQIVNNENPIVQQFLQRWVRLDEREFPEARNAPLKYT
SALTHDAVLVIAEAFRYLRRQRVDVSRRGIAGDCLANPAVPWSQGIDIERALKMVQVQGM
TGNIQFDTYGRRTNYTIDVYEMTPTKPRKVGHWNEYERFVAVPDQQPTNESSSVENKTIV
VTTILENPYVMKKKNHELLDGNDRYEGYCVDLASEIAKHVGIKYKLSIVEDGKYGARDPE
TKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFS
FLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHLEDTDEARDPQNPPDPPNEFGIFN
SLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIES
AEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTDDGVARVRK
SKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRNAVNLAVLKLNE
QGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMMVALIEFC
YKSRAESKRMTLTKNAQNFKPPPAASTQNYATYREGYNVYGTESVKI
Download sequence
Identical sequences B9V8R9
NP_001153154.1.7800 gi|222875740|gb|ACM69012| gi|229892283|ref|NP_001153154|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]