SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296010945|ref|NP_001171575| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296010945|ref|NP_001171575|
Domain Number 1 Region: 247-346
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.69e-25
Family Ras-binding domain, RBD 0.00000577
Further Details:      
 
Domain Number 2 Region: 945-1039
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-22
Family PDZ domain 0.0000362
Further Details:      
 
Domain Number 3 Region: 38-136
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.6e-21
Family Ras-binding domain, RBD 0.011
Further Details:      
 
Domain Number 4 Region: 388-451
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00000000000199
Family FHA domain 0.0000554
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296010945|ref|NP_001171575|
Sequence length 1780
Comment myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog); translocated to, 4 [Xenopus laevis]
Sequence
MSGSREEERRKLADIINHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIR
VSSTATTQDVIETLAEKFRPDMRMLSSPRYSLYEVHVSGEERKLDFEEKPLVVQLNWNKD
DREGRFVLKNENDIFPLKKTQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKRRERDVLKQS
ADKEEGPQLRDDGENLQLAMEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSS
DGRPDSGGTLRIYADSLKPNIPYKTILLSTNDTADFAVIEALEKYGMEKENPKEYCIAKV
VLPPGAQHSDKGMKEFILDDEECPLHIFRDWPSEKGELVFQLKRRPTDSLLKQNRKHESK
SGKSKDRTDHYSLSLSTDKLPYLVELSQLFGPGIQLHHCDLNNMDGVVTVTPRSIDADTY
VDGHHISETTMLHSGVKVQFGSSHVFKFVDPNLDHLLGKRVSDTGQIGKNQRTKQGLQET
TFGLEGDVLGDVTLPANKMVSKLDNERTPSMTERGMVKPIIRMDKQQDQRVQNGRSQDSQ
GPENVLPASIEFRENSEDAFLSAIINYTNSSTVHFKLSPTYVLYMTCRYVLSNKYRPDSN
AAERTHKVIAVVNKMVGMMESVIQKQKNIAGALAFWMANASELLNFIKQDRDLNRITLDA
QDVLAHLVQMAFKYLVHCLQSELTSSMPAFIDDPEENDSQRPKIEDVLHTLTGAMSLLRR
CRVNAALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHYWGAIIRQQLAHIEAWAEKQGL
ELAADCHLSRIVQATTLLTMDKYSHQDIPNINNTCFKLNSLQLQALLQNYHCAPDEPYIP
TELIDSVVSVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVRNIPNGLQEF
LEPLCQRGFCRLVPHPRSPGIWTIYFEGADYENNLLTGNTDLPLRKEPEIITVTLKKQNG
MGLSIVAAKGAGQEKLGIYIKSVVKGGAAEVDGRLAAGDQLISVDGQSLVGLSQERAAEL
MTRTGSVVTLEVAKQGAIYHGLATLLNQPSPLMQRDRRGSGKPRPKSEGFELYNNTSQNG
SPDSPQAQWPEYTEPKKLPGDDKLLKNRADHRSSPNVANQPQSPGGKTTYSSSSTVKITS
VSTGNLCTEEETVPARPETYPIPTQTYAREYFTFPTPKSQDRIGPAQNQWQGYEDKFQVQ
MGNNHARNNSAQQIAYSEEELRDNLAFQSERGHIEPQVQKDMEHLEQNLDAKETWFNRGS
SMESSTSCQDLNNSKTHSMGSLTKTGPGRWKTPISSQTATVLLPQPVRTDLPPPPPPPVH
YGAEFEAVPIDLPLPPPPSENQLGLSANSQAAALERKKREEHQRWYEKEKARLEEERERK
RREQERKLGHVRPQPPTLPPQPVIPQSPPLIPPPNVVQTRTEKPATLPRQQDTVIRELQP
QQQPRTIERRDLQYITVSKEELSSSDSLSPDPWKRDAKEKLEKQQQMHIVDMLSKEINEL
QSKPNRTSEENDRLRKLMLEWQFQKRLQESQQKDDDDDDDEDDDDVDTMLIMQRLEAERK
ARLQDEERRRQQHLEEVRKREAEDRLRQEEEHRHQEEERARREAEEKRRQEEEYYTRLEA
ERRRIHEEADRRLLEPEEPGLYRPPLPREYELSSPTLLPNPPPPPPQRNTSYLKTQALSP
DTVYTAKFVTYTDDEEDTNLSGPNSYSGSSGAAVPSNEVYKGPRDMRLKSQDGEAYGPGG
APESLTFKERQRLFSHGQDVSNKVKASRKLMELENELNTK
Download sequence
Identical sequences D5JEJ8
NP_001171575.1.7800 gi|292606973|gb|ADE34165| gi|296010945|ref|NP_001171575|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]