SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37728649|gb|AAO44922| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37728649|gb|AAO44922|
Domain Number 1 Region: 534-565,649-723
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000392
Family Anti-sigma factor antagonist SpoIIaa 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37728649|gb|AAO44922|
Sequence length 778
Comment anion exchanger SLC26A4 [Xenopus laevis]
Sequence
MATARMDIPSPGYNQYLVHRSVYSEPTFQEENERKEPVRKTLQDRVKKNCSCTSKKALFI
VKKFLPILNWLPKYRWKEWFLSDLISGVSTGLVGTLQGLAFALLAAVPVGYGLYSSFFPI
LTYFFLGTSKHISVGPFPVVSLMVGSVVLSIAPDEKFAILGNSTGLNKTIIDTVARDAAR
VAVSGTLSFLIGIIQLALGVFQIGFIIRYLADPLVGGFTTAAAFQVFVSQFKLVLNVPTK
NYNGVLSIIYTIIDIFTNIAKTNIADLIAGLLTFVVCVVVKEINDRYKRIFRVPIPIEVI
VTIVATGISYGVNLEKKYNAGIVKTIPTGFIPPMTPDVSLFSQIGSSAFSIGIVAYAVAV
SVGKVYATKHNYEVDGNQEFIAFGISNLFGGVFSCFCATTALSRTAIQESTGGKTQIAGI
ISAGIVLIAIVALGKLLEPLQKSVLAAIVIANLKGMFWQVFDVPRLWKQNKWDSVIWVFT
CIASILLGLDLGLLAGLLFGLVTIILRVQFPSCGALGSVPGTDIYKNVKEYKNLIEPEGV
KIIRYTSGMFYGNIDGFKNAIKSIVGFDAVKVYNKRTKALRKIQKLIKKGQLRSTKNGII
SSTGADNEGYEPDDDPEDPEQENNEAVQTKEVEIQVDWNSELPIKVSVPKVSIHSIIFDF
GQIHFIDVVAVRSLKVIFKEFKRIDVEPYIAAYEDGVLQKMEKCFFFDEVIKRDIFFLTV
HDAVLHIENLRKFYDGHDPLLEKISLMQESKEPLEFTTTDPTDQELDAQEGALRSLAH
Download sequence
Identical sequences Q5QKY0
NP_001089008.1.7800 gi|148236113|ref|NP_001089008| gi|37728649|gb|AAO44922|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]