SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|50415325|gb|AAH78021| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50415325|gb|AAH78021|
Domain Number 1 Region: 529-560,644-718
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000283
Family Anti-sigma factor antagonist SpoIIaa 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|50415325|gb|AAH78021|
Sequence length 773
Comment Slc26a4-prov protein [Xenopus laevis]
Sequence
MDIPSPGYNQYLVHRSVYSEPTFQEETERKEPVRKTLQDRVKKNCSCTSKKAYYVAKKFF
PILNWLPNYRWKEWFVSDLISGISTGLVGTLQGLAYALLAAVPVEYGLYSSFFPILTYFF
LGTSKHISVGPFPVVSLMVGSIVLSIAPDEKFTMLANSTGLNKTLIDTVARDTARIVVSG
TLSFLIGIIQLALGVFQIGFIIRYLADPLVGGFTTAAAFQVFVSQIKLVLNVPTKNYNGV
LSIIYTIIDIFTNIAKTNIADLIAGLLTFVACVVVKEINDRYKRIFRVPIPIEIIVTIIA
TGISYGVNLEKKYNAGIVKTIPSGFIPPMTPDVSLFAQLGSSAFSIGIVAYAVAVSVGKV
YATKHNYEVDGNQEFIAFGISNLFSGAFSCFCATTALSRTAVQESTGGKTQIAGIISAGI
VLIAIVALGRLLEPLQKSVLAAIVIANLKGMFCQVFDVPRLWKENKWDSVIWVFTCIASI
LLGLDLGLLAGLLFGLVTIILRVQFPSCGALGNVPGTDIYKNVKEYKNLIEPEGVKIIRY
TSGMFYGNIDGFKNAIKSIVGFDAVKVYNKRTKALRKIQKLIKKGQLRSTKNGIISSTGA
DNEGFEPDDDPEDPEQENNEGVETKEVEIRVDWNSELPVKVYVPKVSIHSIIFDFGQIHF
IDVVAVRSLKVIFKEFKRIDVEPYIAAYEDGVLQKMESCLFFDETIKRDIFFLTVHDAVL
HIENLRKFYDGHDPLLEKISLMQESRELLEFTAVDPTEQELDAQEGALRSLAH
Download sequence
Identical sequences Q6DCJ6
gi|148238146|ref|NP_001087123| gi|50415325|gb|AAH78021|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]