SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000024439 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSXETP00000024439
Domain Number - Region: 180-213
Classification Level Classification E-value
Superfamily DNA primase core 0.0889
Family DNA primase DnaG catalytic core 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000024439   Gene: ENSXETG00000011184   Transcript: ENSXETT00000024439
Sequence length 476
Comment pep:known scaffold:JGI_4.2:GL172766.1:2037676:2051925:-1 gene:ENSXETG00000011184 transcript:ENSXETT00000024439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEWESYQIILTHVSLLKRYKRNFILSIPLQICTLLFSTLYLLSYIVITKFKKHADFATVD
VEDAAVNRIALWMCTFTLAVSVGAVLLLPFSIISNEVLLSVPHNYYIQWLNGSLVHGLWN
LVFLFSNLSLVFLMPFAYLFTEAEGFAGSKKGVMSRVYETSVVLLLLTLLVFGIVWVASA
IFDDDSAGRESLYDLWEYYLPYLYSGISLFGVLLLLLCTPFGLSRMFSVTGKLLVKPRLL
ENLDEHLSCTAFEEAAISRKISTKASCWLNLNMEALQKRLLAIQSHRITLEMRRRASPWQ
RNLVYPLAMLLLLALTGITVLIVCVNVLELLIDEAAMPKGIQGSQLGKVSFSVFGSFGAA
VQVILIFYLMASSVVGFYSSPLFIWLLPQKQNTTMTKIIGNCVSLLILSSALPVFSRTLD
EGITRFDLLGDFGRFNWLGNFYLILLYNMMFAGLATLCLVKKFTWAVQAELIRAFG
Download sequence
Identical sequences F6YTE9
ENSXETP00000024439 ENSXETP00000024439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]