SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000033267 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000033267
Domain Number 1 Region: 397-624
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.84e-28
Family RecA protein-like (ATPase-domain) 0.0061
Further Details:      
 
Domain Number 2 Region: 240-336
Classification Level Classification E-value
Superfamily DNA primase core 0.0000000942
Family Primase fragment of primase-helicase protein 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000033267   Gene: ENSXETG00000015205   Transcript: ENSXETT00000033267
Sequence length 645
Comment pep:known scaffold:JGI_4.2:GL173037.1:130660:141261:-1 gene:ENSXETG00000015205 transcript:ENSXETT00000033267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TWIGPKSLPPMRVLLFLSGSKQAKAGLSGHMVPGEPIRRHFKKGLLTVLDGSLQPVTVTE
IRQYLRSKNVSFRDGYSCLHVPSPFTPERDTCLFIDKTTGRFLCKATLLEGSWEDFQDSM
ELLHKEGCSYLSPDILAGYLAESDSDSAEAQLNDSEVRRIWDKAVWFSDLGEEEAELIKA
MYNITKIANSTLKKFGVKCFQPTKSLVFPWYNPRDFSLNGLKLLSAESHKQKIHYTETTF
PRPARYYNLFGLCVSGKKETEVVITNGEVDCLAIHQSTGVTTLALPRGASCLPPVLLPYL
EQFKRIILWLGDDLRSWEASKLFARKLNMKRCSLIRPGDKQPSPLQALNDGLNITKILKA
SLPASHKSIISFRQLREEVFGQLENADQVAGVKWARFPELNKLLKGHRKGELTVFTGPTG
SGKTTFISEYALDLCIQGVNTLWGSFEINNVRLAKIMLTQFALQRLEEQLDKYDEWADRF
EDLPLYFMTFHGQQNIKSVIDTMQHAVYMYDITHVIIDNLQFMMGQENLYTDRFAAQDYM
VGAFRKFATDNNCHVTVVIHPRKEDDDKELQTSSIFGSAKASQEADNVLILQDRKLVTGP
GKRHLQVAKNRFDGDVGVFSLEFNKPCLSFASTKGKQKVKKLNKD
Download sequence
Identical sequences F7A002
ENSXETP00000033267 ENSXETP00000033267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]