SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000040309 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000040309
Domain Number 1 Region: 5-188
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.9e-55
Family D-ribulose-5-phosphate 3-epimerase 0.00000251
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000040309   Gene: ENSXETG00000018617   Transcript: ENSXETT00000040309
Sequence length 188
Comment pep:known scaffold:JGI_4.2:GL172854.1:1103099:1112809:1 gene:ENSXETG00000018617 transcript:ENSXETT00000040309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGCKIGPSILNSDLSRLGAECDRMLQSGADYLHLDVMDGHFVPNITFGHPVVECLRKQ
LGSDPFFDMHMMVAQPEQWVKPMSAAGANQYTFHLEATNNPGALIKDIRESGMKVGLAIK
PNTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVQWLRSQFPSLDIEVDGGVGP
DNIHRCAE
Download sequence
Identical sequences F7BWX1
ENSXETP00000040309 8364.ENSXETP00000040309 ENSXETP00000040309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]