SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000045872 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000045872
Domain Number 1 Region: 267-413
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 6.52e-27
Family Decarboxylase 0.000026
Further Details:      
 
Domain Number 2 Region: 2-53
Classification Level Classification E-value
Superfamily PRTase-like 0.0000277
Family Phosphoribosyltransferases (PRTases) 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000045872   Gene: ENSXETG00000021215   Transcript: ENSXETT00000045872
Sequence length 418
Comment pep:known scaffold:JGI_4.2:GL175504.1:571:3198:1 gene:ENSXETG00000021215 transcript:ENSXETT00000045872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VADVLYQTARNGGVPYTSVCGVPYTALPIATIICSQHQLPMLIRRKEAKDYGGYGPGSRT
ALVSRDPPLGRAVPGNCIRIRLWAELCQATALVSRDPPLGRAVPGNCIRIRLWAELCQAT
ALVSRDPPLGRAVPGNCFKLCQATALVSRDPPLGRAVPGNCFRIRLWAELCQATALVSRD
PPLGRAVPGNCIRIRLWAELCQATALVSRDPPLGRAVPGIRLWAELCQATALGVGIHLWA
ELCQATALVSRDPPLGRAVPGNCFSGIYRISSWADVVNAHVVPGPGVVQGLREVGGPINR
GCLLIAEMSSEGSLATGDYTKAAVQMAEQHRDFVIGFVSGRRVGRDPALVHLTPGVQVQA
GGDELGQRYQTPYEVIVNKGSDVIIVGRGILSAANRLEVAEMYRRAGWEAYLSAIANE
Download sequence
Identical sequences F6X2G7
ENSXETP00000045872 ENSXETP00000045872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]