SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000054400 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000054400
Domain Number 1 Region: 13-162
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 0.0000000565
Family Tryptophan biosynthesis enzymes 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000054400   Gene: ENSXETG00000025560   Transcript: ENSXETT00000054399
Sequence length 162
Comment pep:known scaffold:JGI_4.2:GL172730.1:2876289:2879872:1 gene:ENSXETG00000025560 transcript:ENSXETT00000054399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFLQLFGTVKPIVIGMVHVKALPGTPGSRLPVAQIIEEACHEAEIYKNAGIDGIMVENM
HDIPYTFNTGPEITATMATICTAVKQACPHLPLGVQILSCANNQALAVALAAGLDFIRAE
GYVFSHVADEGFVNACAGDLLRYRKAIGAEHIQIFADIKKKH
Download sequence
Identical sequences F7CA63
ENSXETP00000054400 8364.ENSXETP00000054400 ENSXETP00000054400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]