SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000004273 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000004273
Domain Number 1 Region: 524-617
Classification Level Classification E-value
Superfamily TAFH domain-like 2.62e-35
Family TAFH domain-like 0.0000034
Further Details:      
 
Domain Number 2 Region: 810-857
Classification Level Classification E-value
Superfamily Histone-fold 3.21e-17
Family TBP-associated factors, TAFs 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000004273   Gene: ENSXETG00000001996   Transcript: ENSXETT00000004273
Sequence length 1023
Comment pep:known scaffold:JGI_4.2:GL173167.1:339679:365630:-1 gene:ENSXETG00000001996 transcript:ENSXETT00000004273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGSDLLDEVFFNTDVDDKVVSELVGSLESQLAAAEQQPPAEARSQALANHVTSPGVGA
ASAGGQPEAKIGLSPEVPKTGAAVPGVQGGVINSRPQTTAQPDGTQSAIPEAPGALSQAK
SGVLGNMASTLPNHSSGNGKNATLQTMNGSNVVINSHGPGGHGTPYQGNSNAAVGLVNNG
PAPVAKGGVNPGANTVIQTSFLGTTNVASSVISSSSTSTAGAAGQQAGMAGVPTSVALVR
PLLHQGVPATQNGSNTVINSPLSAPAGVSLQMNNQPSPVIKSESPKTIIQPPQQSQPNPG
NMVLGQTMQAGHPGPGGAVSAPGAPTGMGKATVSAVPPNLPRTPTALAGGIRATITPPML
APRVPQPQQNPASVQNFQLPPGMVLVRSESGQLLMIPQQALAQMQAQAQAQAQAQAQAQA
QSQSQNTMVPRPATPTSAPPVQISAVQSPGAPLLARQVTPTIIKQVTQAPTTVQPTTTLQ
RPPVVQNQIVLGSTAQTATLGTATAVQTGAAQRPVQGAATPAAATTETMENVKKCKNFLS
TLIKLASSGKQSSETAANVKELVHNLLDGKIEAEDFTSRLYRELNSSPQPYLVPFLKRSL
PALRQLTPDAAAFIQQSQQQQPPTQATTALTAVMLSGSVQRTAGKTTATVTNTLQQPVIS
LTQTAQSKPGQPTPLVIQQAHKAGAVVRPPHVTLTQTPMVALRQPPNRIMLTTQQLQLNP
LQTGAMQTVPMAKQALVQGAKTMSAISAQAAAAQKNKLKEPGGGSFRDDDDINDVASMAG
VNLSEESARILATNSELVGTLTRSCKDETFLLPALLQRRILEIGKKHGITEIHQDVVSYV
SHATQQRLQNIVEKISETAQQKNISHKDDDRYEQTSDVRTQLKFFEQLDQIEKQRKDEQE
REILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKVES
PGPGSGSESSSTSTATASSSAGGGSRQFTRQRITRVNLRDLILCLESERETSHSLLLYKA
FLK
Download sequence
Identical sequences F6WXY1
ENSXETP00000004273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]