SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000012886 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000012886
Domain Number 1 Region: 534-627
Classification Level Classification E-value
Superfamily TAFH domain-like 2.62e-35
Family TAFH domain-like 0.0000034
Further Details:      
 
Domain Number 2 Region: 820-867
Classification Level Classification E-value
Superfamily Histone-fold 3.21e-17
Family TBP-associated factors, TAFs 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000012886   Gene: ENSXETG00000001996   Transcript: ENSXETT00000012886
Sequence length 1033
Comment pep:known scaffold:JGI_4.2:GL173167.1:339679:365644:-1 gene:ENSXETG00000001996 transcript:ENSXETT00000012886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGSDLLDEVFFNTDVDDKVVSELVGSLESQLAAAAHQHHHHHHHQQQPPAEARSQALA
NHVTSPGVGAASAGGQPEAKIGLSPEVPKTGAAVPGVQGGVINSRPQTTAQPDGTQSAIP
EAPGALSQAKSGVLGNMASTLPNHSSGNGKNATLQTMNGSNVVINSHGPGGHGTPYQGNS
NAAVGLVNNGPAPVAKGGVNPGANTVIQTSFLGTTNVASSVISSSSTSTAGAAGQQAGMA
GVPTSVALVRPLLHQGVPATQNGSNTVINSPLSAPAGVSLQMNNQPSPVIKSESPKTIIQ
PPQQSQPNPGNMVLGQTMQAGHPGPGGAVSAPGAPTGMGKATVSAVPPNLPRTPTALAGG
IRATITPPMLAPRVPQPQQNPASVQNFQLPPGMVLVRSESGQLLMIPQQALAQMQAQAQA
QAQAQAQAQAQSQSQNTMVPRPATPTSAPPVQISAVQSPGAPLLARQVTPTIIKQVTQAP
TTVQPTTTLQRPPVVQNQIVLGSTAQTATLGTATAVQTGAAQRPVQGAATPAAATTETME
NVKKCKNFLSTLIKLASSGKQSSETAANVKELVHNLLDGKIEAEDFTSRLYRELNSSPQP
YLVPFLKRSLPALRQLTPDAAAFIQQSQQQQPPTQATTALTAVMLSGSVQRTAGKTTATV
TNTLQQPVISLTQTAQSKPGQPTPLVIQQAHKAGAVVRPPHVTLTQTPMVALRQPPNRIM
LTTQQLQLNPLQTGAMQTVPMAKQALVQGAKTMSAISAQAAAAQKNKLKEPGGGSFRDDD
DINDVASMAGVNLSEESARILATNSELVGTLTRSCKDETFLLPALLQRRILEIGKKHGIT
EIHQDVVSYVSHATQQRLQNIVEKISETAQQKNISHKDDDRYEQTSDVRTQLKFFEQLDQ
IEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAI
GPRKKRKVESPGPGSGSESSSTSTATASSSAGGGSRQFTRQRITRVNLRDLILCLESERE
TSHSLLLYKAFLK
Download sequence
Identical sequences Q0IJ02
ENSXETP00000012886 gi|113197986|gb|AAI21309| gi|118403768|ref|NP_001072285| ENSXETP00000012886 NP_001072285.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]