SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000013074 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000013074
Domain Number 1 Region: 524-554,664-741
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000549
Family Anti-sigma factor antagonist SpoIIaa 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000013074   Gene: ENSXETG00000005947   Transcript: ENSXETT00000013074
Sequence length 796
Comment pep:known scaffold:JGI_4.2:GL173598.1:173029:204715:1 gene:ENSXETG00000005947 transcript:ENSXETT00000013074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKVRPRYIIDRPAYSVELFNEEYEKKIRSYPIGGKARKLFSCSTSKIKNFIFRLFPILS
WLPKYNIKGNLLNDALGGISAGTIQIPQGMAFALLANLPPVNGLYSSFFPLVVYFFMGGI
PQMVPGTFAVISIIVGNVCLKLAPESEFVTINGTSNVTFIDIEAMNGKRMHISATLACLT
AIIQIALSFVQFGFVAIYLSESFIRGFMTAAGLQILISVLKYIFGVSIPPYSGVLAIIYT
FIDICKELPKTNVASLIFALISTVLLIIVKELNMKFMHKIRFPIPMEIIIVVIVATAVSG
SFKLPERYHMNVVGHIPLGFPSPTVPNVTQWDEMVGTAFSLAIVGYVINLAMGRTLGAKH
GFDVDANQEMLALGSGNFFGSFFFIHVICCALSVTLAVDGAGGKSQIASFFVMMSVMVTI
LALGTYLNPLPKSVLGALIAVNLKNSLKQLSDPFYLWKKSKLDCLVWLVSFFSTFILGLP
YGLAVGVAFSILVVIFNTQFRNGSSLNQVTATDIYVNPKVYSKVQPIDGIKIVTYCSPLY
FANSEIFRQKVIKKTGLDPGKVYLSKKKYLKQQEQELKKKEQKKKRGSLFMKNKTLSLQE
LQEDFDGVSPTDSNNNSTVNGTASAISYISSNTLTSGSQTTENVQNGFSTPAQTQDPIIA
APPIVNFHTVIIDMSGVCFVDLMGIKALGKVLFHYNKLFLMILCTCPAQVYDDIENGGMF
AEGSLDRKHLFITVHDAVLYAEANNTGIVNTDSKKKGAGDTEIYIMDTQDEISEDYPNLE
EAMFGSMFQTEIQTAL
Download sequence
Identical sequences F7EDX3
ENSXETP00000013074 ENSXETP00000013074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]