SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000018887 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000018887
Domain Number 1 Region: 627-1022
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 3.61e-111
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000875
Further Details:      
 
Domain Number 2 Region: 291-624
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 2.75e-85
Family Lipovitellin-phosvitin complex, superhelical domain 0.000000106
Further Details:      
 
Domain Number 3 Region: 24-289
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 4.71e-82
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000198
Further Details:      
 
Domain Number 4 Region: 1150-1250
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 5.1e-35
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000018887   Gene: ENSXETG00000027852   Transcript: ENSXETT00000018887
Sequence length 1250
Comment pep:known scaffold:JGI_4.2:GL172642.1:1849871:1866899:-1 gene:ENSXETG00000027852 transcript:ENSXETT00000018887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGIILALLLALAGSEKSQYEPFFSESKTYVYNYEGLILNGIPQNGLARSGIKLNCKVDI
SGYAQRPHLLKIRNPEIKEFNGLWPKDPFTRASKLSQILAEQLTRPAKFEYKNGQVGKIF
AAEDVSETALNIRKGILNLLQVTLKTSQDVYDLQEECISGVCHTKYTVQEDKKADRLTVI
KSRDFDNCQYRVEKKIGVAYMETCSQCQKRAQNLRGSATFTYKLQNKDQGALIVEASAKQ
VYRYTPYYELYGAAVMEARQILTLAETKSNRISESQIQLTNRGGLNYHFWQEEHQMPFQL
LKTKNAESQVVETLQHLVQNNQDLVHGESTSKFLQLVQLLRATNQENIQAIWKQFSDRPQ
HRHWLLNAIPMSGSVDALKFIKQMIHNQDLTHQEAATAILMAMHYTKATQRVVEIAADLV
TDSKVQNFPTLYKSAMLAYGSLVYKYCVDSQSCPEAALQPLHELAAEAASKGHQEEITLA
LKAIGNAGQPASIKWIQKFMHGFSSGASRLPVRVQTDAVMVLRNIAIKDPRKVQEVLLQL
FMDRDVHPEVRMITCVALFETNPGVAIVTAVANAVLRESKDNLQLASFTYSHIKSLSKST
MPEFHNLASACRVALNILNPVFDQLSFRYSKAFHVDTYNYPMMGGLALNVFFINSPRTAL
PVFALVKVRRSFAGASSDIFEFAVRAEGLQEVIRKRNIQFSEYSMPKKIAKILETMLAYK
EAPANVPLVSASIKILGQEVTFNQATRDTIQNAVKLLNEPADRHTVVKKALNRLLSGATG
QWSHPMLVSEARHIIPTCVGFPLEIATHTAAVANAAINADMKVTPSPSNDFSLSQLLESN
IQLHTDMSPSVLIHTVDTMGVNTPVIQSGLEYHGKFRLQAPAKLTAKLDMHGKNFKIETP
PCQREVELLTARHQMFAVTRNVGQLDSEKRMQVVPKQHGPSTLEQHFEKSGRTSAESASM
MYCLRFSKLNINACLQSKLNTAQGDRRSFLYDYIGEHETKFFIKPTQNDAAIEKLQLEIT
AGPGASSKLMALAEVEKTEEARNKSLVGKKRKVKKTKDAAETEVVEAKQNWKQSSSRNSR
HRGSKVDLLSRVSQQAKNKDTHAQTGRNKHRQYKGMSSQSSESSSSSSSSSSSESARSPH
HNKFLGDKKPPTVVITAQAVRNDNAKQGYQVILYTDYTSRPKMQAYVVDITGKSRWRACA
AAYVRNPYEAQAELKWGQNCKQYKMEVVAQTGIFGNQPALRLKVNWPRIP
Download sequence
Identical sequences L7N325
ENSXETP00000018887 ENSXETP00000018887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]