SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000026775 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000026775
Domain Number 1 Region: 523-555,638-712
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000255
Family Anti-sigma factor antagonist SpoIIaa 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000026775   Gene: ENSXETG00000025660   Transcript: ENSXETT00000026775
Sequence length 761
Comment pep:known scaffold:JGI_4.2:GL172681.1:3577821:3605733:-1 gene:ENSXETG00000025660 transcript:ENSXETT00000026775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADVVENKYLVARPIYSEDSFSSDHEIVERRHKTLLDHLKRICTCSPQKAKKVALSFLPV
LTWLPAYRFKEWLLSDIISGVTTGLVAVLQGGLAYALLANVAPGYGLYTSFFPVVVYFFF
GSSRHVSAGPFPVVSLMVGSVVASVVPGDTTSFSNSTNGTNEALIEQQRMIVASSLCFLV
GIIQLALGLLQVGFIVIYLSDPLINGFTTAAAIEVVVSQLKYMFGIKIPSFSGPLSIFYS
LESIFSQITSTNIPDLIIGIIIMVLVYIVKELNVKYKAKLPVPIPIEIILTIITAGLSYG
FNFKDRFQVTTVGAIQKGYQPPLAPSIEVFQTTIANAFSIAIVGFAVAFSVAKVYAIKHN
YNVDGNQQELIAFGLSNIVCGSFRGFAASTSLSRSSVQESTGGKTQVAGIISGIIVLIVT
LAVGYLLEPLPKSVLAGVIIINLKGMLMKFNEIPVLFKRDKFDCLVWILTFIAALLLGLD
LGLAVGVGIELLTVVFRVQFPKYSVIANVGRTDIYRNKKDYSEIYEPEGVKIFRSPAPLF
FANADFFRDKIIAATGFNPLWVLRKRNKALRKIKKLLKKGELQVTPKGLVTVSPDCKDIE
DEELDNNKVEELDQPTYTADLPADIDWNADLPMDIVVPKVNIHSLILDFGAVSFIDLSGM
KVLKGTLKDFLKIDVDVYIVGADCGVLEKLTMSNFFDNEVKTSMFFLTVHDAVLHVLEKK
GLKGTLINGTLKESENILYTSEASNGTLRERPNQVANETKF
Download sequence
Identical sequences F6VK44
ENSXETP00000026775 ENSXETP00000026775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]