SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000028478 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000028478
Domain Number 1 Region: 331-433
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.11e-26
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0031
Further Details:      
 
Domain Number 2 Region: 64-147
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000262
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 3 Region: 146-201
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000628
Family BphP N-terminal domain-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000028478   Gene: ENSXETG00000012988   Transcript: ENSXETT00000028478
Sequence length 711
Comment pep:known scaffold:JGI_4.2:GL172658.1:2331380:2371481:1 gene:ENSXETG00000012988 transcript:ENSXETT00000028478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPTAVNPSEMTTDIPGSVSLPGAAMATGQVRMAGPMPARGGKRRSGMDFDDEDGEGPS
KFSRENHSEIERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTGN
KSTDGAYKPSFLTEQELKHLILEAADGFLFVVASETGRVIYVSDSVTPVLNQPQSEWFGS
TLYEQTHPDDIEKLREQLCTSENSMTGFLLDISVKSLHGIYVILSPYMCLSDMFSHRCGN
APLDHLPLNRISTMRKRYRNGLGPVKEGEAQYSVVHCTGYIKAWPPAGMTIPEEDAEVGQ
GSKYCLVAIGRLQVTSSPGSLDMNGMSLPTEFLSRHSTEGVITFVDPRCISIIGYQPQDL
LGKDIIEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFHTKTRDWMLLRTSSFTFQNPYS
DEIEYIICTNTNVKQVQQQQAELEVHPRDSLSSYDLSQVPVPNLAANVHEGGKSVVDKPD
PIFSQDRDPRFAEMFAGITASEKKMLSASGSGTQQLYSTGSPFQPGHSGKSFSSSVVHVT
GVNEIQSPSATGQNLTQISRQMNAGQVWTGSRPPFQGQQIASQTSKPQSSPFGIGTSHTY
TSDPSTYSPLSSPATSSPSGNAYSSLGGRSAAFTETGQSSSQFQGRASEVWSQWQSQHHN
QPSSEQHPHQQPAQAEVFQDMLPMSGDPTQGTGNYNIEDFADLGMFPPFSE
Download sequence
Identical sequences F6PV68
8364.ENSXETP00000028478 ENSXETP00000028478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]