SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000047657 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000047657
Domain Number 1 Region: 528-560,644-718
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000022
Family Anti-sigma factor antagonist SpoIIaa 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000047657   Gene: ENSXETG00000022019   Transcript: ENSXETT00000047657
Sequence length 773
Comment pep:known scaffold:JGI_4.2:GL172956.1:1050127:1071245:-1 gene:ENSXETG00000022019 transcript:ENSXETT00000047657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLGIMESSSDNKYLVTRSVYSEPAFQEQHEKREIIHKPFKQKLKNTFSCTPKKAFGIAKT
LIPVLDWLPKYRWKEWILQDIIAGVSVGLISALQGLAFGLMAGVPIQFGLYSSFFPVLMY
CFFGTSRHISVAGPFPVVCLMVGIVTISMAPDEQFAITINGTETAIDTAARDAARISICG
TLTFLIGILQLSLGVFQIGFIVRYLADPLIGGFTTAAAFQVTVTQIKTILNVPAKNYNGV
LSIIYTIIDIFSNIAQTNFADLIAGLLTLVIVLVVKEINERYKEKIRIPIPIEIIVTIVA
TGISYGANLAGKYNAGIIKTIPSGFIPPASPDVSLFSQLISSAFSIGIVAYAIAISVGKV
YGTKNNYKVNGNQEFIAFGISNMFAGVFSCFCASTALSRTAIQEGTGGKTQIAGMISALM
VLIAIVAIGRLLEPLQKSVLAAIVVANLKGMYMQVRDIPVLWRQNRWDAVIWVFTCISAI
ILGLDLGLLAGLVFGLLTVVLRVQFPSCTSLANIPHTDLYKDVKIYKELIEPGGVRIIRF
SSGIFYGNIEGLKSGIKKIVGFDAARVFNKRTKALRRIEKLIKKGQLGATWNGIVSGSGM
DNEGFEPDDEPDDQEVEQNQEIHTNEVEIQVDWNSDLPLTVSVPKVTVHTIIFDFAQVAF
LDVVAVKSLKLIYKEFKRIDVDIYIAACDDKVYNKMEICGFFDDAIKPDIFFLTVHDAML
YIEKERKFESASDPIFRRISLMQENKGQLDFVELDPVHEELAVHEEAIRRYAS
Download sequence
Identical sequences F6PIG5
ENSXETP00000047657 ENSXETP00000047657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]