SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000047792 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000047792
Domain Number 1 Region: 2000-2298
Classification Level Classification E-value
Superfamily BEACH domain 1.14e-123
Family BEACH domain 0.0000000117
Further Details:      
 
Domain Number 2 Region: 2418-2690
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.48e-29
Family WD40-repeat 0.0028
Further Details:      
 
Domain Number 3 Region: 1875-1963
Classification Level Classification E-value
Superfamily PH domain-like 8.2e-24
Family PreBEACH PH-like domain 0.0029
Further Details:      
 
Domain Number 4 Region: 598-748
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000826
Family Laminin G-like module 0.051
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000047792
Domain Number - Region: 142-384,474-562
Classification Level Classification E-value
Superfamily ARM repeat 0.000141
Family PBS lyase HEAT-like repeat 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000047792   Gene: ENSXETG00000022086   Transcript: ENSXETT00000047792
Sequence length 2708
Comment pep:known scaffold:JGI_4.2:GL172948.1:297433:389375:1 gene:ENSXETG00000022086 transcript:ENSXETT00000047792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRERLYELWMLYCNKKDPDYLRLWLDSFVSGYEQFLDVDFDELPTRIDDEPPGLSLLP
DHILQVLRLQLLYCVQKTADGMEEEQQTLSLLLVKFFIIICRNLSNVEEIGCCSYINHVI
TMTTLYVQQLKSNTKEKELMDQSSTEEFVRHALVFCESLYDPYRNWRQIIAGKIICPVEK
SRQKYKAASLTVEFIPFFYQCFQESEHLKESLKCCLLHLFGSILSGSQRNALQAISPATI
EVLMRILADCDTWNDGDTGEVSRKAELTLKCLTEVIHILLVSSSDQRQVEISTILENYFK
LLNSDHSALSSQRRSRHWENRFITLQIKMLTCMTDMLNCKDRPVLQAIFLNSNCFEHLIR
LLQNCRLLLNANYRGAEKSEKELVNKLLTEMNENQVFQERLDRLSVTTIQALTAVKHKSP
SAKEVFKERIGYAHFLDVLKSLGQPTRLLLEELLNMAVEGDHNIVGILGISNVQPLLLLI
QWLPEIQSHDLQIFISEWLKRICCINKQSRTMCVNANMVIRIIETLNSHYSLHRACAENL
IGLLGSLGSQSMSSEELFHLLSLLRTKEHKQSHPYVIPVTRALLAITRKQGLCSALQYFN
LSHSLAGIAVPTVQKWPGSAFSFFAWLCLDQDQSFSAVSSSGTKRKQLYSFFTSSGTGFE
AFITSSGVLVVAVCTKKEYATVMLPDHCFCDSLWHNVTIVHVPGKRPFGQSFVYIYVNGQ
QKASAPLKFPSMNEAFTSCCIGSAGQRTNTPPPSQIPDPPISPPSAGTRTSLGGILSSPS
WSGTHGKTDGVTKLISAGTQDSEWGSPTSLEGHLGSVLIFHDVLQAAQVKTLYLAGPNSL
SLWKSQESELTDLPTKLLLYYTPKACKNPICLDLSSNVLHGRLTGNKVVNWDIKDMINCI
GGLNSLFPLLEQISYLNELPCEKTDSCVTATEHLTPIEGDFVVLSSTKASEARLEKNIVA
TFILLIKHLIQRHPINQEVLTYSHGVATLGVLLQKVSGNLMDVNVLMAVQLLIEQVSVEK
NTLLLQQMYQYLLFDFRIWNRGDFPFRIGKFFKCITSRQQPHRVPECWLYVIYIYCKSLS
TSYIKFWIISKENALAADDLTTIRTSLFGLIKYFLSKGGAPEEIQSIIGYIAAITDEEQI
YGILEIILHLLNGSPVLDQLFLLLFEPGSADMLYALLLNQRYSDKLKETVFKIFEQMLKC
NKVYEKSKQRIRLREVGYSGLGLLLNDSSISTVLIKGLLNQILTADTINYKDLLAVVHLS
TRADLTVRVAVCRKILQLLQFQHDAAFQVCQQVGWQETLVRFFLKENLECKSNFRASCTD
SIKEDEQNAVSEETQKQSSEEVVMDQADGCTLNNNQYNSYFPEDLTPFDAGFRENQIPGS
LPSTPSPVENSKQFVMNQSDKDSNSLKNVFFRDDLSLSVNMESREDCEEELVQLVTDILL
CLMWKGLDKSDSATWIERGQIFSALTCLESSSMLLRSSDEIKLNLLEKMPEWAVTENRES
KSQPIYCENAKRLLHIVQDFLQTEGLKNPVLWTEKLLEEIVTLMDGISVWYSSGPESESL
SQLEFRLLLGFIAQDNLQVCAMAAAKLNTLLQTKVIENQEEACYLLGKLEGILGKSIKEK
TETYSFLIPIVRTLVSKIYQLLFMHLHLPSLPITNGNPSLFEDFQEYCNSDEWRIFIDKY
IILYMKQYEVDTFGKCHEQMATYWKECYEAQMVNMHKRERERGESKLKFKEFFLEPFNRK
TRQENSRYNNMLKQVNSQYTATLRQWKAAQRYLFCERGPWADRKENWQYWKLSTVENYSR
MRLKLVQNLNFDAHLEASALRDNLGVQQTEPSSESLLLEAAKQVKVSDLEEDQLELPEEE
NVVNMNDKEEQIQKEKLVLSEECDLITVMDAISGHLEVTTQHIYFYDGSTEKEEGTEYSV
GFDFKWPLSQIREIHLRRYNLRRSALEIFLIDQTNYFLNFKKEVPQLPWVTNLSKKPFQP
TTKVRNKVYSRILSLRLPNIYGTRSPQELLKASGLTQKWVNREISNFDYLIQLNTIAGRT
YNDLAQYPVFPWVLQDYTSEELDLNNPAVFRDLSKPIGVVNEKNAAIVKDKYESFEDPLG
TIDKFHYGTHYSNAAGVMHYLIRVEPYTTLHIQLQSGRFDCADRQFHSIPATWQALMDNP
NDVKELIPEFFYFPEFLENKNGFDLGHLQITKEQVNDVILPKWAKSPEDFILKHRKALES
EFVSAHLHEWIDLIFGYKQRGPAAIEALNVFYYCTYEEPGAVDLDAIANEKERKALEGMI
NNFGQTPCQLLKEPHPTRLSAEEVYLKQSKLDNVTLNLFQNLPDLKSFFIEGISDDVPVV
KAIVPKNQLRSFLSPGSPELLVTVSQTLIIGTHGWLPYDRTISNYFTFSKDQTVTNPKTQ
RLVSGPFAPGLEITSKLFVVSHDGKVLFSGGHWDNSIRVTSLTKGKVTSQHIRHMDIVTC
LSTDFCGIHLISGSRDTTCMIWQIGQQGGDLSSKPLQILYGHTDEITSVCISTELDTAVS
GAKDGAVIIHTIRRGQYVRTLKPPSESSLLMSIPNLAMSLDGHIVIHSSIEVERPLSNIE
FNKNALHLYSINGKYLVSELLKEQVTDMCIISENIVLGSRQGFLSIRDLYSLNLSLTPLV
MRVPIHCVSVTKENSHILVGLEDGKLIIVGIGKPAEARSGQISRKLWGSSRRLSQISSGV
TEYNTQAT
Download sequence
Identical sequences F6Q424
ENSXETP00000047792 ENSXETP00000047792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]