SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000053343 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000053343
Domain Number 1 Region: 216-356
Classification Level Classification E-value
Superfamily PH domain-like 1.13e-41
Family Third domain of FERM 0.000000509
Further Details:      
 
Domain Number 2 Region: 106-214
Classification Level Classification E-value
Superfamily Second domain of FERM 3.79e-35
Family Second domain of FERM 0.000000899
Further Details:      
 
Domain Number 3 Region: 19-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.37e-25
Family First domain of FERM 0.00000609
Further Details:      
 
Domain Number 4 Region: 509-612
Classification Level Classification E-value
Superfamily Moesin tail domain 9.02e-23
Family Moesin tail domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000053343   Gene: ENSXETG00000016421   Transcript: ENSXETT00000053343
Sequence length 612
Comment pep:known scaffold:JGI_4.2:GL172727.1:546541:574925:1 gene:ENSXETG00000016421 transcript:ENSXETT00000053343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAIASRMNFTSLKRKQPKTFIVRIITMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETW
FFGLQYTVKDTIAWLKMDKKVLDHDVPKEEPVTFHFLAKFYPENVEEELVQDITQHLFFL
QQVKKQILEEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAEEELLPKRVINLYQM
TPEMWEERITAWYAEHRGRTRDEAEMEYLKIAQDTEMYGVNYFLIRNKKGTELLLGVDAL
GLHIYDLENRLTPKTSFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQL
CIGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQLREEAERARDELERR
LLQLKEEAQMANDALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRN
EEEKRLMEQKVMETEMLAIKMAEESERRVKEAEQLKQDLQEARDSERRAKQKLLEISSKT
SYMQAAGAASSSSTVPPTDVPSFSMLSDSLPYDFKDTDMKRLSMEIEKEKVEYMEKSRHL
QEQLNELKTEIESLKLKERESAMDIMHENAGSKQNTIKKLGEESCLHLSVIHSVCQLTLQ
STQCRVAFFEEL
Download sequence
Identical sequences F7AZR8
ENSXETP00000053343 ENSXETP00000053343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]