SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000053773 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000053773
Domain Number 1 Region: 620-1044
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 9.81e-114
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000769
Further Details:      
 
Domain Number 2 Region: 282-617
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 6.41e-82
Family Lipovitellin-phosvitin complex, superhelical domain 0.000000169
Further Details:      
 
Domain Number 3 Region: 17-282
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.69e-79
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000019
Further Details:      
 
Domain Number 4 Region: 1300-1469
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.8e-53
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000053773   Gene: ENSXETG00000025072   Transcript: ENSXETT00000053773
Sequence length 1662
Comment pep:novel scaffold:JGI_4.2:GL172642.1:1883659:1909289:-1 gene:ENSXETG00000025072 transcript:ENSXETT00000053773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLALACSERTQIEPVFSESKTSVYNYEAVILNGFPESGLSRAGIKINCKVEISAFAQRS
YFIKIQSPEIKEYNGVWPKDPFTRSSKLTQALADQLTKPAKFVYSNGRVGDIFVPDDVSD
TVVNIYRGIINLFQLTIKKSQNVYDLQESSVGGICHTRYVLQEDRRGDRINIIKATDFSN
CQEKVSKGIGFDLTESCASCKQIHRNIHGAATYTYKLKARDQGTVIMEVTSRQVIQFTPF
AERNGAGTMEARQILVWIGSKSGHMNPPQIQLKNRGNLHYQFASELHQMPIHLMKTKSPE
AQAVEVLQHLIQDTQQQIREDAPAKFLQLIQLLRASDFENIQALWKQFAQRTQYRRWLLD
AIPMAGTVDCLKLIKQLIHNEELSPQEAAVTITFAMRSARPSQQALQLSADFVQDSKVQK
YNTVHKAAILAYGTMVKKYCDQLSSCPEHALEPLHELAAEAANKGHAEIIALALKALGNA
GQPESIKQIQKFLPAITSSAYQLPVGIQTDAVMALRNIAKQETTKVREILLQIFMDRDAR
TEVRMMACLALFETKPGLATVTTIANVAARESKTNLQLASFTYSQMKALAKSSVAQLKPL
AAACTVALKILNPSLDNLGYRYSKVMRVDTFKYNLMAGGAGKVYIMNSANTMFPVFILAK
FREYLAGIESDILEIGIRGEGIEEFLRKQNTQFADFPMHKKISQIVKTMLGFKGLPSQKP
LLSGYVKLLGQEIAFTNINKEVIQNIIRQALNEPAERHTMIRNLLNKLLGGVVGQYAKAW
MTGEYRYIIPTTVGLPAEFSLYHSAIVNAAVNSDIKVKPNPSEDFSVAQLLESQVQLNAD
VKPSLMFYKVGTMGINSRLLQAGIEFHGKVHAHLPAKFTAYLDMKERNFKIETPPCQQEN
HLVELRAQTFVVTRNIEDLDAAKKNLVVPRNSEPNILKKHFDSTGRSSAEGASMIEVSSE
MAPRKYSREPGQHQNAPANVNSYDACTKFSKAGVNFCIQCKTHNAAAHRNTFLYQAIGEH
EFKLTMKPARTDRVIEKLQLEIATGPKAASKLMGLVEVEDTKGEQLDDVAVQKRLKLILG
IDDSAKNTNVTAILRSRPSKKEHKVHNRTLDAEVVQARKQQSSSRRHQNQQQEESSSSSS
QEQDKNKNRQDKNKNRQEMWSKKKQFLYPQHHRNFYDLHFRRAARTQVSYADAFTHSLNS
PKMPNISAPQNPKTAKTNVPELYNKNTNLYSHSSHITKLCELMQKQKPIITEMYSRPRKS
LANTKQQGSQSSSSSESSSSSSQSVSANRHKTKFLGDKQSPVFVATFRAVLNDNTKQGYQ
MVLYQDYHSSKQQIQAYVMDISKTRWAACLDAVVNNQYDAQASLKWGQNCQDYKINFKAQ
TGHFGNQPALKLTADLPKIPSKWKSTGKYVADYVPGGMYMLGFQGEYRRNSQRQVKLVFA
LSSPRTCDIVMQMPRFTVYYRALRLPLSIPVGHHAKESVLQTPTWNIFAEAPQIIMNSLQ
GECKVAQNQITTFNGIEFASVLPENCYHVLVQDCSHELKFMILMRNSKESPNHKAINVKL
GAYDIDMNYSPKSLKMKINGIEVPEERLPYFLVSDPTVEIKKKGDGVSISAPEYGIESLD
FDGLTFKMRAALWMKGKTCGICGRNDDESEKEFQMPDGSMAK
Download sequence
Identical sequences F7A9C1
ENSXETP00000053773 ENSXETP00000053773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]