SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000056892 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000056892
Domain Number 1 Region: 26-103
Classification Level Classification E-value
Superfamily Histone-fold 4.49e-64
Family Nucleosome core histones 0.00000672
Further Details:      
 
Domain Number 2 Region: 10-102
Classification Level Classification E-value
Superfamily CATH 6.64e-43
Family CATH 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000056892   Gene: ENSXETG00000027200   Transcript: ENSXETT00000056892
Sequence length 103
Comment pep:known scaffold:JGI_4.2:GL173396.1:80363:80674:-1 gene:ENSXETG00000027200 transcript:ENSXETT00000056892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Download sequence
Identical sequences A0A023FHA6 A0A023GDJ7 A0A074ZML9 A0A087QLZ6 A0A087UHZ2 A0A087YSG3 A0A091EES9 A0A091FJ24 A0A091FVA8 A0A091HJI2 A0A091NCP5 A0A091P8Z0 A0A091RHT3 A0A091X3V5 A0A093BKK2 A0A093C8R7 A0A093GGD7 A0A093HLR0 A0A093NLY6 A0A094KVC1 A0A094ZWN9 A0A096N7J3 A0A099ZR16 A0A099ZYX2 A0A0D9SD09 A0A0F8BJR4 A0A0G1Z8R5 A0A0J7N8E3 A0A0L8GB53 A0A0N7I0H5 A0A0Q3X480 A0A0R3SFR8 A0A0R3TMV4 A0A0R3W1I4 A0A0R3WQK5 A0A0S7G218 A0A131Z809 A0A132ACK5 A0A147AZK7 A0A151NSZ8 A0A173DW71 A0A183A155 A0A183KLC5 A0A183N445 A0A183NQ77 A0A183R1T4 A0A183T510 A0A183VKI2 A0A1A6H926 A0A1A8AWK4 A0A1A8EUC1 A0A1A8P5E9 A0A1B4XSS2 A0A1L8G0S8 A0A1S3AGB8 A0A1S3FW03 A0A1S3K088 A0A1S3R432 A0A1U7QTV0 A0A1U7RL50 A0A1U7TD77 A0A1V9XAM9 A0A1W7RAF1 A0A1Y3ARX0 A0A1Z5LH91 A0A224YPP2 A0A226NC93 A0A226P6P0 A0A250Y902 A0A293LRC1 A0A2D0QKF3 A0A2D4L9V0 A0A2H1C2E7 A0A2H5INY8 A0A2I4CDV8 A0A2J8SQS4 A0A2K5C4F9 A0A2K5HQ15 A0A2K5KNY8 A0A2K5RGW2 A0A2K5XIB1 A0A2K6B0J7 A0A2K6ETK4 A0A2K6JVN2 A0A2K6NQ10 A0A2K6SBG6 A2CI30 A3KPR4 A7VME9 B2R4R0 B2RTM0 B3FEB2 B3FEB7 B5DDY3 B5FXC8 C1C500 C3XQS8 C4QBN1 D2HZU2 D2N2J2 D5J6Z3 D9IA14 E7D161 F2Z4N2 F6PX78 F6VFV9 F7EBQ9 F7FGL0 F7HAP8 F8J4K6 G1NRJ0 G1QEI3 G1SAW1 G1UJD7 G3H2T6 G3MN54 G3N8J1 G3RXT8 G3UJE6 G3VQV7 G5BKL3 G7P2N0 G7YVN1 G9L0N9 H0W865 H0XJY6 H2L385 H2RC04 H2RUY8 H3A5H1 H9GM55 I3N7M0 K1R2N0 K7EXN6 L5JWL7 L5M483 L8HXY8 L8YAP0 M3WSM7 M7B1W2 M7ZMQ6 P62794 P62795 P62796 P62797 P62798 P62799 P62800 P62801 P62802 P62803 P62804 P62805 P62806 Q28DR4 Q45RT4 Q4PM69 Q4R362 Q4SKJ2 Q5DET3 Q5RCS7 Q6WV72 Q6WV73 Q6WV90 Q7K8C0 Q7KQD1 R0KA48 R7T3W2 R7VVJ9 S7MN86 S9W978 T1G8J7 T1IH11 T1JYV7 U3KKH1 U6CNP2 U6HLD5 U6IWB0 U6JN05 V4B6N0 V8N8S2 W5LS51 W5QGB5
ENSFCAP00000016486 ENSFCAP00000017021 ENSFCAP00000017363 ENSFCAP00000018055 ENSFCAP00000020102 ENSFCAP00000020806 ENSFCAP00000021135 ENSFCAP00000022352 ENSFCAP00000023430 ENSFCAP00000023485 ENSFCAP00000024869 ENSFCAP00000024926 ENSORLP00000000025 ENSORLP00000000194 ENSORLP00000000196 ENSORLP00000000211 ENSORLP00000014776 ENSORLP00000014779 ENSORLP00000024501 ENSDORP00000004903 ENSDORP00000004920 ENSDORP00000004930 ENSDORP00000008219 ENSDORP00000008224 ENSDORP00000014213 ENSDORP00000015390 ENSSTOP00000015496 ENSSTOP00000016311 ENSSTOP00000016356 ENSSTOP00000016752 ENSSTOP00000019588 ENSSTOP00000020326 ENSSTOP00000020366 ENSSTOP00000020581 ENSSTOP00000022899 ENSMICP00000000255 ENSMICP00000005483 ENSMICP00000005492 ENSMICP00000007507 ENSMICP00000007693 ENSMICP00000010567 ENSMICP00000015726 gi|123915922|sp|Q28DR4| gi|197246663|gb|AAI68455| gi|301608744|gb|XP_002933937| gi|301608750|gb|XP_002933940| gi|301621183|gb|XP_002939952| gi|301621215|gb|XP_002939926| gi|301621221|gb|XP_002939928| gi|301626314|gb|XP_002942338| gi|301627981|gb|XP_002943144| gi|301627983|gb|XP_002943143| gi|301628500|gb|XP_002943389| gi|301628504|gb|XP_002943391| gi|301630250|gb|XP_002944234| gi|301630569|gb|XP_002944389| gi|301630984|gb|XP_002944594| gi|301631145|gb|XP_002944667| gi|301632584|gb|XP_002945362| gi|301632820|gb|XP_002945478| gi|62857709|ref|NP_001016869| gi|89272717|gb|CAJ83618| ENSTBEP00000001747 ENSTBEP00000004385 ENSTBEP00000010838 ENSTBEP00000013104 HmN_000547400.1 HmN_000548200.1 ENSCAFP00000019126 ENSCAFP00000033563 ENSCAFP00000034229 ENSCAFP00000036545 ENSCAFP00000037324 ENSCAFP00000037435 ENSCAFP00000038752 ENSCAFP00000040694 ENSCAFP00000042617 ENSCAFP00000043106 jgi|Helro1|187742 jgi|Helro1|92568 jgi|Helro1|92695 ENSTNIP00000002729 ENSTNIP00000003147 ENSTNIP00000007878 ENSTNIP00000011586 ENSTNIP00000011594 ENSTNIP00000011625 ENSTNIP00000011626 ENSXETP00000001377 ENSXETP00000044316 ENSXETP00000054182 ENSXETP00000054185 ENSXETP00000054589 ENSXETP00000054958 ENSXETP00000055001 ENSXETP00000055237 ENSXETP00000055544 ENSXETP00000056117 ENSXETP00000056585 ENSXETP00000056587 ENSXETP00000056849 ENSXETP00000056865 ENSXETP00000056866 ENSXETP00000056870 ENSXETP00000056873 ENSXETP00000056877 ENSXETP00000056881 ENSXETP00000056888 ENSXETP00000056892 ENSXETP00000056935 ENSXETP00000057375 ENSXETP00000058765 ENSXETP00000058860 ENSXETP00000058936 ENSXETP00000059040 ENSXETP00000059551 ENSXETP00000059940 ENSXETP00000060763 ENSXETP00000060942 ENSXETP00000061001 ENSXETP00000061007 ENSXETP00000061040 ENSXETP00000061355 ENSXETP00000061494 ENSXETP00000061740 ENSXETP00000061885 ENSXETP00000062175 ENSXETP00000062199 ENSXETP00000062223 ENSXETP00000062225 ENSXETP00000062375 ENSXETP00000062392 ENSXETP00000062836 ENSXETP00000063397 ENSXETP00000063763 Ocbimv22001847m.p Ocbimv22023446m.p Ocbimv22035552m.p Ocbimv22036526m.p ENSGALP00000041526 10090.ENSMUSP00000085006 10116.ENSRNOP00000034519 10116.ENSRNOP00000039070 10116.ENSRNOP00000039602 10116.ENSRNOP00000039949 10116.ENSRNOP00000041042 10116.ENSRNOP00000041383 10116.ENSRNOP00000042649 10116.ENSRNOP00000045905 10116.ENSRNOP00000046288 10116.ENSRNOP00000063647 10141.ENSCPOP00000015632 13616.ENSMODP00000004700 28377.ENSACAP00000004275 28377.ENSACAP00000004566 28377.ENSACAP00000004575 28377.ENSACAP00000015025 28377.ENSACAP00000015041 28377.ENSACAP00000015204 28377.ENSACAP00000015206 28377.ENSACAP00000017749 28377.ENSACAP00000017912 31033.ENSTRUP00000003007 31033.ENSTRUP00000003756 31033.ENSTRUP00000003881 31033.ENSTRUP00000003956 31033.ENSTRUP00000004758 31033.ENSTRUP00000006859 31033.ENSTRUP00000009756 31033.ENSTRUP00000010470 31033.ENSTRUP00000022836 31033.ENSTRUP00000029439 31033.ENSTRUP00000039554 31033.ENSTRUP00000039742 59729.ENSTGUP00000009591 59729.ENSTGUP00000009603 59729.ENSTGUP00000009605 59729.ENSTGUP00000009611 59729.ENSTGUP00000014754 6182.Q5DET3 69293.ENSGACP00000000349 69293.ENSGACP00000000567 69293.ENSGACP00000001626 69293.ENSGACP00000001644 69293.ENSGACP00000001659 69293.ENSGACP00000002671 69293.ENSGACP00000002703 69293.ENSGACP00000002721 69293.ENSGACP00000003371 69293.ENSGACP00000003380 69293.ENSGACP00000003537 69293.ENSGACP00000003542 69293.ENSGACP00000003570 69293.ENSGACP00000003576 69293.ENSGACP00000003693 69293.ENSGACP00000003714 69293.ENSGACP00000003730 69293.ENSGACP00000018374 69293.ENSGACP00000018382 69293.ENSGACP00000018399 69293.ENSGACP00000019637 6945.ISCW019498-PA 7739.JGI114886 7739.JGI115927 7739.JGI127106 7739.JGI129780 7739.JGI200361 7739.JGI200543 7739.JGI200683 7739.JGI200696 7739.JGI200752 7739.JGI200764 7739.JGI227374 7739.JGI285548 7739.JGI56954 7739.JGI61348 7739.JGI64838 7739.JGI64845 7955.ENSDARP00000077832 7955.ENSDARP00000082327 7955.ENSDARP00000097961 7955.ENSDARP00000098038 7955.ENSDARP00000098063 7955.ENSDARP00000098737 7955.ENSDARP00000099502 7955.ENSDARP00000101862 7955.ENSDARP00000102436 7955.ENSDARP00000102541 7955.ENSDARP00000102569 7955.ENSDARP00000104322 7955.ENSDARP00000104379 8090.ENSORLP00000000025 8090.ENSORLP00000000194 8090.ENSORLP00000000196 8090.ENSORLP00000000211 8090.ENSORLP00000014776 8090.ENSORLP00000014779 8090.ENSORLP00000024501 8364.ENSXETP00000001377 8364.ENSXETP00000044316 8364.ENSXETP00000052343 8364.ENSXETP00000053643 8364.ENSXETP00000053646 8364.ENSXETP00000053649 8364.ENSXETP00000053653 8364.ENSXETP00000054142 8364.ENSXETP00000054182 8364.ENSXETP00000054185 8364.ENSXETP00000054395 8364.ENSXETP00000054589 8364.ENSXETP00000054676 8364.ENSXETP00000054958 8364.ENSXETP00000055001 8364.ENSXETP00000055165 8364.ENSXETP00000055173 8364.ENSXETP00000055178 8364.ENSXETP00000055237 8364.ENSXETP00000055544 8364.ENSXETP00000055690 8364.ENSXETP00000055808 8364.ENSXETP00000055881 8364.ENSXETP00000056108 8364.ENSXETP00000056117 8364.ENSXETP00000056194 8364.ENSXETP00000056197 8364.ENSXETP00000056199 8364.ENSXETP00000056202 8364.ENSXETP00000056585 8364.ENSXETP00000056587 8364.ENSXETP00000056842 8364.ENSXETP00000056846 8364.ENSXETP00000056849 8364.ENSXETP00000056865 8364.ENSXETP00000056866 8364.ENSXETP00000056868 8364.ENSXETP00000056870 8364.ENSXETP00000056873 8364.ENSXETP00000056877 8364.ENSXETP00000056881 8364.ENSXETP00000056888 8364.ENSXETP00000056892 8364.ENSXETP00000056935 8364.ENSXETP00000057367 8364.ENSXETP00000057375 8364.ENSXETP00000057465 8364.ENSXETP00000058082 8364.ENSXETP00000058084 8364.ENSXETP00000058097 8364.ENSXETP00000058158 9031.ENSGALP00000037289 9031.ENSGALP00000037296 9031.ENSGALP00000037309 9031.ENSGALP00000037319 9258.ENSOANP00000000312 9258.ENSOANP00000000314 9258.ENSOANP00000000327 9258.ENSOANP00000000337 9258.ENSOANP00000000348 9258.ENSOANP00000000351 9258.ENSOANP00000000384 9258.ENSOANP00000000389 9258.ENSOANP00000005895 9258.ENSOANP00000005952 9258.ENSOANP00000008691 9258.ENSOANP00000012131 9258.ENSOANP00000018119 9258.ENSOANP00000020666 9258.ENSOANP00000028063 9258.ENSOANP00000028920 9258.ENSOANP00000029082 9258.ENSOANP00000029084 9258.ENSOANP00000029085 9258.ENSOANP00000029094 9361.ENSDNOP00000008611 9361.ENSDNOP00000013266 9361.ENSDNOP00000015675 9361.ENSDNOP00000015836 9361.ENSDNOP00000016065 9361.ENSDNOP00000016431 9544.ENSMMUP00000001926 9544.ENSMMUP00000001935 9544.ENSMMUP00000005840 9544.ENSMMUP00000012596 9544.ENSMMUP00000031247 9544.ENSMMUP00000031248 9544.ENSMMUP00000031273 9544.ENSMMUP00000034283 9544.ENSMMUP00000034308 9544.ENSMMUP00000034312 9544.ENSMMUP00000034321 9544.ENSMMUP00000040172 9598.ENSPTRP00000002100 9598.ENSPTRP00000008064 9598.ENSPTRP00000030386 9598.ENSPTRP00000030387 9598.ENSPTRP00000030393 9598.ENSPTRP00000030400 9598.ENSPTRP00000030415 9598.ENSPTRP00000030447 9598.ENSPTRP00000030448 9598.ENSPTRP00000050485 9600.ENSPPYP00000001075 9600.ENSPPYP00000004934 9600.ENSPPYP00000018228 9600.ENSPPYP00000018229 9600.ENSPPYP00000018235 9600.ENSPPYP00000018242 9600.ENSPPYP00000018245 9600.ENSPPYP00000018249 9600.ENSPPYP00000018255 9600.ENSPPYP00000018269 9600.ENSPPYP00000018279 9600.ENSPPYP00000018280 9600.ENSPPYP00000018285 9600.ENSPPYP00000019358 9606.ENSP00000289352 9606.ENSP00000343282 9606.ENSP00000346316 9606.ENSP00000347168 9606.ENSP00000348258 9606.ENSP00000350159 9606.ENSP00000350767 9606.ENSP00000352980 9606.ENSP00000353624 9606.ENSP00000358153 9606.ENSP00000358162 9606.ENSP00000366581 9606.ENSP00000366974 9606.ENSP00000367034 9615.ENSCAFP00000019126 9615.ENSCAFP00000033563 9685.ENSFCAP00000005545 9685.ENSFCAP00000006288 9685.ENSFCAP00000009377 9685.ENSFCAP00000009541 9685.ENSFCAP00000010044 9685.ENSFCAP00000012992 9796.ENSECAP00000001598 9796.ENSECAP00000001742 9796.ENSECAP00000002229 9796.ENSECAP00000002344 9796.ENSECAP00000002796 9796.ENSECAP00000003055 9796.ENSECAP00000003604 9796.ENSECAP00000004124 9796.ENSECAP00000004479 9796.ENSECAP00000005357 9796.ENSECAP00000005553 9796.ENSECAP00000005600 9796.ENSECAP00000005877 9823.ENSSSCP00000001182 9823.ENSSSCP00000001190 9823.ENSSSCP00000001193 9823.ENSSSCP00000001199 9823.ENSSSCP00000001209 9823.ENSSSCP00000001211 9823.ENSSSCP00000001237 9823.ENSSSCP00000001240 9823.ENSSSCP00000001241 9823.ENSSSCP00000001246 9823.ENSSSCP00000007118 9913.ENSBTAP00000013455 9913.ENSBTAP00000029245 9913.ENSBTAP00000033280 9913.ENSBTAP00000033281 9913.ENSBTAP00000033288 9913.ENSBTAP00000042409 9913.ENSBTAP00000042428 9913.ENSBTAP00000042460 9913.ENSBTAP00000042466 9913.ENSBTAP00000042467 9913.ENSBTAP00000043354 9913.ENSBTAP00000047761 9913.ENSBTAP00000052235 9913.ENSBTAP00000053034 99883.ENSTNIP00000002729 99883.ENSTNIP00000003147 99883.ENSTNIP00000007878 99883.ENSTNIP00000011586 99883.ENSTNIP00000011594 99883.ENSTNIP00000011625 99883.ENSTNIP00000011626 ENSMODP00000004700 ENSTRUP00000003007 ENSTRUP00000003756 ENSTRUP00000003881 ENSTRUP00000003956 ENSTRUP00000004758 ENSTRUP00000006859 ENSTRUP00000009756 ENSTRUP00000010470 ENSTRUP00000022836 ENSTRUP00000029439 ENSTRUP00000039554 ENSTRUP00000039742 ENSGMOP00000004141 ENSGMOP00000021197 ENSGMOP00000021199 ENSGMOP00000021203 ENSGMOP00000021245 ENSGMOP00000021373 ENSGMOP00000021416 ENSGMOP00000021433 ENSGMOP00000021501 ENSGMOP00000021502 ENSGMOP00000021522 ENSGMOP00000021539 ENSGMOP00000021648 ENSGMOP00000021775 ENSGMOP00000021875 ENSGMOP00000021876 ENSGMOP00000021921 ENSGMOP00000021974 ENSGMOP00000022012 ENSGMOP00000022061 ENSCHOP00000003815 ENSCHOP00000004732 ENSCHOP00000006436 ENSCHOP00000007328 ENSCHOP00000009065 ENSCHOP00000009485 ENSCHOP00000011554 ENSAMEP00000019540 ENSAMEP00000019625 ENSAMEP00000020391 ENSAMEP00000020631 ENSAMEP00000020761 ENSAMEP00000020794 ENSAMEP00000020984 ENSAMEP00000021006 ENSAMEP00000021016 ENSETEP00000001580 ENSETEP00000002878 ENSETEP00000011662 ENSETEP00000012667 ENSETEP00000013361 EgrG_000323100.1 ENSTSYP00000001036 ENSTSYP00000002276 ENSTSYP00000004563 ENSTSYP00000013242 ENSTSYP00000013612 ENSTSYP00000013626 ENSDNOP00000024160 ENSDNOP00000026853 ENSDNOP00000028890 ENSDNOP00000029265 ENSDNOP00000029778 ENSDNOP00000030816 ENSDNOP00000033936 ENSBTAP00000029245 ENSBTAP00000033280 ENSBTAP00000033281 ENSBTAP00000033288 ENSBTAP00000042409 ENSBTAP00000042428 ENSBTAP00000042460 ENSBTAP00000042466 ENSBTAP00000042467 ENSBTAP00000047761 ENSBTAP00000052235 ENSBTAP00000053034 ENSBTAP00000054635 ENSETEP00000001580 ENSETEP00000002878 ENSETEP00000011662 ENSETEP00000012667 ENSETEP00000013361 gi|11415030|ref|NP_068803.1| gi|28173560|ref|NP_778224.1| gi|4504301|ref|NP_003529.1| gi|4504303|ref|NP_003530.1| gi|4504305|ref|NP_003531.1| gi|4504307|ref|NP_003532.1| gi|4504309|ref|NP_003533.1| gi|4504311|ref|NP_003534.1| gi|4504313|ref|NP_003535.1| gi|4504315|ref|NP_003536.1| gi|4504317|ref|NP_003537.1| gi|4504321|ref|NP_003486.1| gi|4504323|ref|NP_003539.1| gi|77539758|ref|NP_001029249.1| ENSOANP00000000312 ENSOANP00000000314 ENSOANP00000000327 ENSOANP00000000337 ENSOANP00000000348 ENSOANP00000000351 ENSOANP00000000384 ENSOANP00000000389 ENSOANP00000005895 ENSOANP00000005952 ENSOANP00000008691 ENSOANP00000012131 ENSOANP00000018119 ENSOANP00000020666 ENSOANP00000028063 ENSOANP00000028920 ENSOANP00000029082 ENSOANP00000029084 ENSOANP00000029085 ENSOANP00000029094 ENSOGAP00000007155 ENSOGAP00000007163 ENSOGAP00000007174 ENSOGAP00000014667 ENSOGAP00000014669 ENSOGAP00000014682 ENSOGAP00000015804 ENSOGAP00000016426 ENSOGAP00000017744 ENSOGAP00000018514 ENSOGAP00000021177 ENSOGAP00000022330 ENSMUSP00000085006 ENSMUSP00000100029 ENSMUSP00000100030 ENSMUSP00000100032 ENSMUSP00000100033 ENSMUSP00000100036 ENSMUSP00000100037 ENSMUSP00000100042 ENSMUSP00000100044 ENSMUSP00000100048 ENSMUSP00000100546 ENSMUSP00000129930 ENSMUSP00000136357 ENSP00000244537 ENSP00000347168 ENSP00000350767 ENSP00000366956 ENSP00000366974 ENSP00000367034 ENSP00000443017 ENSP00000462355 ENSP00000462667 ENSP00000478519 ENSP00000478786 ENSP00000479106 ENSP00000479461 ENSP00000479794 ENSP00000480960 ENSP00000481343 ENSP00000481486 ENSP00000481507 ENSP00000482412 ENSP00000484789 ENSTGUP00000009591 ENSTGUP00000009603 ENSTGUP00000009605 ENSTGUP00000009611 ENSTGUP00000014754 ENSEEUP00000000370 ENSEEUP00000000554 ENSEEUP00000008076 ENSEEUP00000014283 ENSEEUP00000014407 ENSSSCP00000001246 ENSSSCP00000020000 ENSSSCP00000020802 ENSSSCP00000022043 ENSSSCP00000022767 ENSSSCP00000026166 ENSSSCP00000027849 ENSPSIP00000000546 ENSPSIP00000001420 ENSPSIP00000001542 ENSPSIP00000001575 ENSPSIP00000001587 ENSPSIP00000001601 ENSTNIP00000002729 ENSTNIP00000003147 ENSTNIP00000007878 ENSTNIP00000011586 ENSTNIP00000011594 ENSTNIP00000011625 ENSTNIP00000011626 ENSONIP00000026073 SMAR000114-PA ENSORLP00000000025 ENSORLP00000000194 ENSORLP00000000196 ENSORLP00000000211 ENSORLP00000014776 ENSORLP00000014779 ENSORLP00000024501 ISCW019498-PA cath|current|1eqzD00/14-102 cath|current|1eqzH00/8-102 ENSMUSP00000085006 ENSMUSP00000088283 ENSMUSP00000100029 ENSMUSP00000100030 ENSMUSP00000100032 ENSMUSP00000100033 ENSMUSP00000100036 ENSMUSP00000100037 ENSMUSP00000100042 ENSMUSP00000100044 ENSMUSP00000100048 ENSMUSP00000100546 ENSMUSP00000129930 ENSAPLP00000001555 ENSAPLP00000001682 ENSAPLP00000001709 ENSAPLP00000001720 ENSAPLP00000001739 ENSLACP00000004892 ENSGGOP00000006237 ENSGGOP00000018935 ENSGGOP00000019841 ENSGGOP00000020335 ENSGGOP00000020625 ENSGGOP00000021745 ENSGGOP00000021754 ENSGGOP00000024364 ENSGGOP00000027594 ENSSSCP00000001246 ENSSSCP00000020000 ENSSSCP00000020802 ENSSSCP00000022043 ENSSSCP00000022767 ENSSSCP00000026166 ENSSSCP00000027849 ENSTGUP00000009591 ENSTGUP00000009603 ENSTGUP00000009605 ENSTGUP00000009611 ENSTGUP00000014754 ENSMMUP00000001926 ENSMMUP00000001935 ENSMMUP00000005840 ENSMMUP00000012596 ENSMMUP00000031247 ENSMMUP00000031248 ENSMMUP00000031273 ENSMMUP00000034283 ENSMMUP00000034308 ENSMMUP00000034312 ENSMMUP00000034321 ENSMMUP00000040172 ENSOGAP00000007155 ENSOGAP00000007163 ENSOGAP00000007174 ENSOGAP00000014667 ENSOGAP00000014669 ENSOGAP00000014682 ENSOGAP00000015804 ENSOGAP00000016426 ENSOGAP00000017744 ENSOGAP00000018514 ENSOGAP00000021177 ENSOGAP00000022330 ENSACAP00000004275 ENSACAP00000004566 ENSACAP00000015041 ENSACAP00000015204 ENSACAP00000015206 ENSACAP00000017912 ENSACAP00000019009 ENSACAP00000019109 ENSRNOP00000034519 ENSRNOP00000039070 ENSRNOP00000039602 ENSRNOP00000039949 ENSRNOP00000041042 ENSRNOP00000041383 ENSRNOP00000042649 ENSRNOP00000045905 ENSRNOP00000046288 ENSRNOP00000063647 tetur02g04230 tetur03g01690 tetur03g01730 ENSCPOP00000015632 ENSCPOP00000015632 EKC28010 EKC28015 EKC28021 EKC28026 EKC28031 EKC28036 EKC28041 ENSPTRP00000008064 ENSPTRP00000030386 ENSPTRP00000030387 ENSPTRP00000030393 ENSPTRP00000030447 ENSPTRP00000030448 ENSPTRP00000050485 ENSPTRP00000056593 ENSAMEP00000019540 ENSAMEP00000019625 ENSAMEP00000020391 ENSAMEP00000020631 ENSAMEP00000020761 ENSAMEP00000020794 ENSAMEP00000020984 ENSAMEP00000021006 ENSAMEP00000021016 ENSNLEP00000022182 ENSNLEP00000022243 ENSNLEP00000022244 ENSNLEP00000022250 ENSNLEP00000022254 ENSNLEP00000022257 ENSNLEP00000022261 ENSNLEP00000022267 ENSNLEP00000022419 ENSNLEP00000022647 ENSNLEP00000022655 ENSNLEP00000022660 ENSPPYP00000001075 ENSPPYP00000004934 ENSPPYP00000018228 ENSPPYP00000018229 ENSPPYP00000018235 ENSPPYP00000018242 ENSPPYP00000018245 ENSPPYP00000018249 ENSPPYP00000018255 ENSPPYP00000018269 ENSPPYP00000018279 ENSPPYP00000018280 ENSPPYP00000018285 ENSPPYP00000019358 ENSCJAP00000020244 ENSCJAP00000020252 ENSCJAP00000020351 ENSCJAP00000040450 ENSCJAP00000040580 ENSCJAP00000040836 ENSCJAP00000041055 ENSCJAP00000044723 ENSECAP00000001598 ENSECAP00000001742 ENSECAP00000002229 ENSECAP00000002344 ENSECAP00000002796 ENSECAP00000003055 ENSECAP00000003604 ENSECAP00000004124 ENSECAP00000004479 ENSECAP00000005357 ENSECAP00000005553 ENSECAP00000005600 ENSECAP00000005877 ENSDNOP00000008611 ENSDNOP00000013266 ENSDNOP00000015675 ENSDNOP00000015836 ENSDNOP00000016065 ENSDNOP00000016431 ENSAMXP00000025744 EmuJ_000031300.1 EmuJ_000031400.1 EmuJ_000323000.1 EmuJ_000323100.1 EmuJ_000367100.1 EmuJ_000384600.1 EmuJ_000385100.1 EmuJ_000385500.1 EmuJ_000386600.1 EmuJ_000387100.1 EmuJ_000387600.1 EmuJ_000388100.1 ENSPSIP00000000546 ENSPSIP00000001420 ENSPSIP00000001542 ENSPSIP00000001575 ENSPSIP00000001587 ENSPSIP00000001601 ENSEEUP00000000370 ENSEEUP00000000554 ENSEEUP00000008076 ENSEEUP00000014283 ENSEEUP00000014407 ENSDORP00000004903 ENSDORP00000004920 ENSDORP00000004930 ENSDORP00000008219 ENSDORP00000008224 ENSDORP00000014213 ENSDORP00000015390 ENSPVAP00000014487 ENSPVAP00000015564 ENSPVAP00000015566 ENSPVAP00000016600 ENSPVAP00000016609 ENSPVAP00000016619 ENSPVAP00000016937 ENSPVAP00000016996 ENSPVAP00000017026 ENSDARP00000077832 ENSDARP00000082327 ENSDARP00000101311 ENSDARP00000101467 ENSDARP00000101862 ENSDARP00000104379 ENSDARP00000105059 ENSDARP00000105168 ENSDARP00000105496 ENSDARP00000106245 ENSDARP00000106443 ENSDARP00000106496 ENSDARP00000106634 ENSDARP00000107028 ENSDARP00000107148 ENSDARP00000107547 ENSDARP00000107585 ENSDARP00000107946 ENSDARP00000107998 ENSDARP00000109044 ENSDARP00000109071 ENSDARP00000109257 ENSDARP00000109299 ENSDARP00000109355 ENSDARP00000110935 ENSDARP00000111175 ENSDARP00000111526 ENSDARP00000111786 ENSDARP00000111930 ENSDARP00000112034 ENSSHAP00000002157 ENSSHAP00000003533 ENSSHAP00000003584 ENSSHAP00000004046 ENSSHAP00000005562 ENSSHAP00000022186 ENSSHAP00000022198 ENSMUSP00000085006 ENSMUSP00000100029 ENSMUSP00000100030 ENSMUSP00000100032 ENSMUSP00000100033 ENSMUSP00000100036 ENSMUSP00000100037 ENSMUSP00000100042 ENSMUSP00000100044 ENSMUSP00000100048 ENSMUSP00000100546 ENSMUSP00000129930 ENSMUSP00000136357 ENSMPUP00000018492 ENSMPUP00000018499 ENSMPUP00000019801 ENSMPUP00000018492 ENSMPUP00000018499 ENSMPUP00000019801 ENSFALP00000015525 ENSMEUP00000001254 ENSMEUP00000002898 ENSMEUP00000003595 ENSMEUP00000008941 ENSMEUP00000010573 ENSMEUP00000010575 ENSMEUP00000013088 ENSMEUP00000014319 1eqz_D 1eqz_H 1f66_B 1f66_F 1hq3_D 1hq3_H 1tzy_D 1tzy_H 1u35_B 1u35_F 2aro_D 2aro_H 2cv5_B 2cv5_F 2f8n_B 2f8n_F 3nqu_B 3r45_B 4hga_C 4kgc_B 4kgc_F 4ld9_B 4ld9_F 4z2m_H 4z2m_J 4zux_B 4zux_F 4zux_L 4zux_P 5c3i_C 5c3i_G 5c3i_K 5c3i_O 5c3i_S 5c3i_W 5e5a_B 5e5a_F 5kgf_B 5kgf_F 5o9g_B 5o9g_F 5omx_B 5omx_F 5ong_B 5ong_F 5onw_B 5onw_F 5x0x_B 5x0x_F 5xf3_B 5xf3_F 5xf4_B 5xf4_F 5xf5_B 5xf5_F 6buz_B 6buz_F 6etx_J 6etx_N 6ftx_B 6ftx_F 6g0l_B 6g0l_F HGL_H00000376668-1 HGL_H00000376668-10 HGL_H00000376668-2 HGL_H00000376668-3 HGL_H00000376668-4 HGL_H00000376668-7 HGL_H00000376668-8 HGL_H00000376668-9 ENSSARP00000001853 ENSSARP00000001905 ENSSARP00000003763 ENSSARP00000004390 ENSSARP00000008069 ENSSARP00000009373 ENSSARP00000009376 ENSSARP00000012117 ENSNLEP00000022182 ENSNLEP00000022243 ENSNLEP00000022244 ENSNLEP00000022250 ENSNLEP00000022254 ENSNLEP00000022257 ENSNLEP00000022261 ENSNLEP00000022267 ENSNLEP00000022419 ENSNLEP00000022647 ENSNLEP00000022655 ENSNLEP00000022660 ENSACAP00000004275 ENSACAP00000004566 ENSACAP00000015041 ENSACAP00000015204 ENSACAP00000015206 ENSACAP00000017912 ENSACAP00000019009 ENSACAP00000019109 ENSTSYP00000001036 ENSTSYP00000002276 ENSTSYP00000004563 ENSTSYP00000013242 ENSTSYP00000013612 ENSTSYP00000013626 ENSLACP00000004892 1tzyD ENSCJAP00000020244 ENSCJAP00000020351 ENSCJAP00000040450 ENSCJAP00000040580 ENSPFOP00000020218 ENSPFOP00000020223 ENSPFOP00000020943 ENSPFOP00000020966 ENSPCAP00000002399 ENSPCAP00000011015 ENSPCAP00000013208 ENSPCAP00000014871 ENSPCAP00000016064 ENSOANP00000000312 ENSOANP00000000314 ENSOANP00000000327 ENSOANP00000000337 ENSOANP00000000348 ENSOANP00000000351 ENSOANP00000000384 ENSOANP00000000389 ENSOANP00000005895 ENSOANP00000005952 ENSOANP00000008691 ENSOANP00000012131 ENSOANP00000018119 ENSOANP00000020666 ENSOANP00000028063 ENSOANP00000028920 ENSOANP00000029082 ENSOANP00000029084 ENSOANP00000029085 ENSOANP00000029094 ENSP00000289352 ENSP00000343282 ENSP00000346316 ENSP00000347168 ENSP00000348258 ENSP00000350159 ENSP00000350767 ENSP00000352980 ENSP00000353624 ENSP00000358153 ENSP00000358162 ENSP00000366581 ENSP00000366974 ENSP00000367034 ENSP00000462355 ENSP00000462667 NP_001016869.1.99540 NP_001029249.1.87134 NP_001029249.1.92137 NP_001032932.1.86415 NP_001032934.1.86415 NP_001087926.1.7800 NP_001092231.1.45394 NP_001116941.1.100692 NP_001116941.1.4139 NP_001128961.1.23681 NP_001139343.1.59421 NP_001139343.1.76553 NP_001182350.1.92730 NP_001232835.1.42559 NP_001258150.1.4139 NP_001268414.1.86415 NP_003486.1.87134 NP_003486.1.92137 NP_003529.1.87134 NP_003529.1.92137 NP_003530.1.87134 NP_003530.1.92137 NP_003531.1.87134 NP_003531.1.92137 NP_003532.1.87134 NP_003532.1.92137 NP_003533.1.87134 NP_003533.1.92137 NP_003534.1.87134 NP_003534.1.92137 NP_003535.1.87134 NP_003535.1.92137 NP_003536.1.87134 NP_003536.1.92137 NP_003537.1.87134 NP_003537.1.92137 NP_003539.1.87134 NP_003539.1.92137 NP_068803.1.87134 NP_068803.1.92137 NP_073177.1.100692 NP_073177.1.4139 NP_291074.1.92730 NP_694813.1.92730 NP_776305.1.59421 NP_776305.1.76553 NP_778224.1.87134 NP_778224.1.92137 NP_783583.1.92730 NP_783585.1.92730 NP_783586.1.92730 NP_783587.1.92730 NP_783588.1.92730 NP_835499.1.92730 NP_835500.1.92730 NP_835515.1.92730 NP_835582.1.92730 NP_835583.1.92730 WP_064670237.1.53646 WP_064670237.1.71371 WP_064670237.1.87253 WP_064670237.1.914 XP_001086761.1.72884 XP_001088506.1.72884 XP_001095996.1.72884 XP_001233180.1.86415 XP_001332711.1.45394 XP_001362863.1.35504 XP_001363291.1.35504 XP_001364265.1.35504 XP_001364497.1.35504 XP_001488440.1.31192 XP_001507620.1.37387 XP_001509578.1.37387 XP_001512010.1.37387 XP_001512868.1.37387 XP_001512921.1.37387 XP_001513324.1.37387 XP_001513920.1.37387 XP_001514186.1.37387 XP_001514518.1.37387 XP_001514546.1.37387 XP_001514697.1.37387 XP_001515421.1.37387 XP_002194484.1.42559 XP_002402623.1.51680 XP_002595194.1.56174 XP_002595647.1.56174 XP_002595664.1.56174 XP_002595680.1.56174 XP_002595692.1.56174 XP_002595712.1.56174 XP_002595720.1.56174 XP_002613645.1.56174 XP_002662243.1.45394 XP_002666964.1.45394 XP_002684676.1.76553 XP_002697516.1.76553 XP_002714257.1.1745 XP_002721667.1.1745 XP_002731240.1.86028 XP_002731862.1.86028 XP_002733165.1.86028 XP_002733243.1.86028 XP_002733412.1.86028 XP_002737706.1.86028 XP_002739628.1.86028 XP_002740598.1.86028 XP_002742217.1.86028 XP_002746168.1.60252 XP_002816560.3.23681 XP_002823024.3.23681 XP_002832997.1.23681 XP_002928573.1.58354 XP_002928574.1.58354 XP_002928589.1.58354 XP_002933940.1.99540 XP_002942338.1.99540 XP_002943144.1.99540 XP_002944234.1.99540 XP_003202248.1.16129 XP_003202257.1.16129 XP_003224527.1.98722 XP_003225091.1.98722 XP_003225094.1.98722 XP_003226704.1.98722 XP_003265584.1.23891 XP_003308403.1.37143 XP_003363837.1.31192 XP_003391251.1.10788 XP_003416451.1.64505 XP_003416454.1.64505 XP_003416468.1.64505 XP_003421151.1.64505 XP_003451199.1.78416 XP_003454720.1.78416 XP_003458488.1.78416 XP_003459140.1.78416 XP_003459577.1.78416 XP_003459580.1.78416 XP_003468850.1.53824 XP_003468852.1.53824 XP_003498672.1.69978 XP_003502226.1.69978 XP_003512223.1.69978 XP_003512227.1.69978 XP_003640418.1.86415 XP_003703732.1.71094 XP_003740515.1.18380 XP_003746286.1.18380 XP_003746455.1.18380 XP_003749904.3.100692 XP_003775634.1.23681 XP_003788847.1.62490 XP_003800469.1.62490 XP_003804476.1.60992 XP_003804598.1.60992 XP_003810986.1.60992 XP_003816562.1.60992 XP_003944781.1.74449 XP_003967844.1.43653 XP_003967879.1.43653 XP_003972551.1.43653 XP_003976989.1.43653 XP_003979221.1.43653 XP_003979769.1.43653 XP_003979855.1.43653 XP_003979857.1.43653 XP_003985732.1.62641 XP_003985737.1.62641 XP_003985815.1.62641 XP_004019094.1.66739 XP_004019121.1.66739 XP_004019131.1.66739 XP_004019376.1.66739 XP_004026587.1.27298 XP_004026589.1.27298 XP_004026591.1.27298 XP_004026593.1.27298 XP_004043430.1.27298 XP_004043465.1.27298 XP_004043490.1.27298 XP_004052835.1.27298 XP_004065520.1.28442 XP_004065542.1.28442 XP_004065543.1.28442 XP_004065546.1.28442 XP_004065570.1.28442 XP_004065575.1.28442 XP_004076665.1.28442 XP_004084101.1.28442 XP_004084204.1.28442 XP_004092159.1.23891 XP_004273518.1.21590 XP_004273527.1.21590 XP_004273529.1.21590 XP_004273546.1.21590 XP_004273615.1.21590 XP_004281169.1.21590 XP_004286155.1.21590 XP_004286156.1.21590 XP_004315563.1.83887 XP_004316319.1.83887 XP_004316328.1.83887 XP_004317749.1.83887 XP_004325607.1.83887 XP_004384089.1.4749 XP_004407048.1.74151 XP_004413691.1.74151 XP_004413703.1.74151 XP_004413710.1.74151 XP_004432106.1.5094 XP_004435457.1.5094 XP_004443950.1.5094 XP_004463549.1.11602 XP_004463550.1.11602 XP_004463559.1.11602 XP_004463567.1.11602 XP_004463573.1.11602 XP_004463580.1.11602 XP_004477772.1.11602 XP_004481913.1.11602 XP_004481914.1.11602 XP_004564911.1.88231 XP_004564942.1.88231 XP_004566501.1.88231 XP_004588886.1.84141 XP_004592637.1.84141 XP_004598447.1.84141 XP_004598451.1.84141 XP_004618106.1.94378 XP_004621946.1.94378 XP_004621993.1.94378 XP_004626144.1.9945 XP_004632474.1.9945 XP_004640163.1.9945 XP_004640176.1.9945 XP_004659161.1.11716 XP_004670890.1.11716 XP_004670896.1.11716 XP_004670964.1.11716 XP_004694928.1.23501 XP_004695478.1.23501 XP_004755846.1.14098 XP_004778831.2.14098 XP_004778836.1.14098 XP_004845889.1.39548 XP_004847596.1.39548 XP_004847597.1.39548 XP_004847621.1.39548 XP_004847863.1.39548 XP_004847871.1.39548 XP_004847877.1.39548 XP_004917044.1.99540 XP_004917053.1.99540 XP_004917057.1.99540 XP_004917064.1.99540 XP_004919473.1.99540 XP_004919478.1.99540 XP_004919480.1.99540 XP_004937726.1.86415 XP_005003350.1.53824 XP_005012217.1.99704 XP_005039647.1.66865 XP_005039651.1.66865 XP_005039652.1.66865 XP_005072948.1.91757 XP_005150336.1.78019 XP_005163249.1.45394 XP_005170788.1.45394 XP_005172452.1.45394 XP_005172454.1.45394 XP_005237425.1.75256 XP_005308996.1.60341 XP_005308998.1.60341 XP_005313473.1.60341 XP_005313480.1.60341 XP_005331192.1.77405 XP_005337104.1.77405 XP_005337152.1.77405 XP_005364576.1.66349 XP_005369960.1.66349 XP_005372471.1.66349 XP_005378769.1.28644 XP_005403352.1.28644 XP_005403388.1.28644 XP_005421692.1.5688 XP_005441366.1.10750 XP_005441368.1.10750 XP_005455914.1.78416 XP_005462225.1.78416 XP_005465169.1.78416 XP_005466235.1.78416 XP_005480798.1.73095 XP_005480800.1.73095 XP_005515110.1.63277 XP_005515118.1.63277 XP_005519540.1.90289 XP_005519550.1.90289 XP_005519554.1.90289 XP_005519555.1.90289 XP_005553865.1.63531 XP_005553874.1.63531 XP_005553915.1.63531 XP_005595820.1.63531 XP_005603685.1.31192 XP_005677765.1.57651 XP_005701750.1.57651 XP_005734221.1.53837 XP_005753323.1.53837 XP_005755482.1.53837 XP_005800079.1.87360 XP_005812310.1.87360 XP_005817476.1.87360 XP_005863145.1.60319 XP_005893766.1.15283 XP_005896914.1.15283 XP_005900936.1.15283 XP_005903677.1.15283 XP_005906209.1.15283 XP_005906214.1.15283 XP_005907808.1.15283 XP_005910222.1.15283 XP_005921124.1.24487 XP_005937148.1.24487 XP_005953537.2.24487 XP_005954921.1.78601 XP_005959639.1.78601 XP_005960027.1.78601 XP_005982803.1.78601 XP_005982809.1.78601 XP_006014945.1.24877 XP_006024243.1.24877 XP_006045704.1.26621 XP_006045706.1.26621 XP_006048046.1.26621 XP_006048077.1.26621 XP_006048083.1.26621 XP_006048084.1.26621 XP_006048100.1.26621 XP_006049259.1.26621 XP_006055198.1.26621 XP_006055199.1.26621 XP_006055200.1.26621 XP_006055201.1.26621 XP_006055202.1.26621 XP_006105757.1.53796 XP_006105773.1.53796 XP_006105898.1.53796 XP_006125962.1.96668 XP_006125963.1.96668 XP_006125968.1.96668 XP_006125969.1.96668 XP_006125970.1.96668 XP_006162718.1.99106 XP_006162724.1.99106 XP_006162731.1.99106 XP_006168565.1.99106 XP_006170025.1.99106 XP_006195502.1.101512 XP_006195527.1.101512 XP_006215323.1.17985 XP_006216973.1.17985 XP_006218987.1.17985 XP_006220086.1.17985 XP_006269554.2.47583 XP_006269556.1.47583 XP_006733829.1.47382 XP_006735957.1.47382 XP_006735963.1.47382 XP_006735964.1.47382 XP_006735968.1.47382 XP_006735977.1.47382 XP_006735981.1.47382 XP_006736831.1.47382 XP_006750237.1.47382 XP_006760037.1.95426 XP_006760044.1.95426 XP_006781036.1.46954 XP_006781087.1.46954 XP_006781098.1.46954 XP_006785219.1.46954 XP_006806874.1.46954 XP_006806875.1.46954 XP_006809850.1.46954 XP_006812122.1.86028 XP_006814524.1.86028 XP_006814802.1.86028 XP_006814804.1.86028 XP_006816988.1.86028 XP_006818183.1.86028 XP_006820570.1.86028 XP_006820573.1.86028 XP_006820576.1.86028 XP_006823987.1.86028 XP_006825353.1.86028 XP_006825355.1.86028 XP_006872852.1.41390 XP_006872866.1.41390 XP_006872935.1.41390 XP_006876126.1.41390 XP_006880153.1.29581 XP_006888689.1.29581 XP_006903434.1.29581 XP_006919777.1.64745 XP_006923511.1.64745 XP_006923521.1.64745 XP_006923527.1.64745 XP_006923537.1.64745 XP_006923553.1.64745 XP_006931451.1.62641 XP_006931453.1.62641 XP_006931456.1.62641 XP_006933596.1.62641 XP_006935130.1.62641 XP_006976576.1.50099 XP_006988914.1.50099 XP_006993206.1.50099 XP_006993213.1.50099 XP_006993220.1.50099 XP_007059789.1.26238 XP_007064094.1.26238 XP_007064095.1.26238 XP_007064096.1.26238 XP_007064110.1.26238 XP_007064142.1.26238 XP_007074498.1.5354 XP_007082828.1.5354 XP_007088094.1.5354 XP_007105890.1.24612 XP_007107817.1.24612 XP_007114492.1.24612 XP_007128640.1.24612 XP_007128663.1.24612 XP_007128668.1.24612 XP_007179086.1.59432 XP_007179092.1.59432 XP_007179093.1.59432 XP_007179108.1.59432 XP_007196100.1.59432 XP_007238183.1.101067 XP_007427785.1.37977 XP_007429383.1.37977 XP_007441164.1.37977 XP_007445089.1.37977 XP_007445390.1.37977 XP_007454692.1.90284 XP_007454693.1.90284 XP_007463536.1.90284 XP_007471301.1.90284 XP_007471305.1.90284 XP_007471317.1.90284 XP_007471323.1.90284 XP_007485413.1.35504 XP_007531640.1.11023 XP_007534627.1.11023 XP_007534645.1.11023 XP_007545198.1.10163 XP_007555237.1.10163 XP_007561738.1.10163 XP_007561746.1.10163 XP_007623300.2.28591 XP_007624055.1.28591 XP_007634642.1.28591 XP_007634645.1.28591 XP_007634656.1.28591 XP_007634659.1.28591 XP_007634698.2.28591 XP_007637951.2.69978 XP_007882955.1.63211 XP_007883224.1.63211 XP_007883954.1.63211 XP_007883983.1.63211 XP_007948051.1.48129 XP_007948074.1.48129 XP_007971617.1.81039 XP_007971654.1.81039 XP_007971666.1.81039 XP_007971667.1.81039 XP_008018012.1.81039 XP_008018013.1.81039 XP_008055236.1.4292 XP_008055785.1.4292 XP_008055798.1.4292 XP_008069394.1.4292 XP_008071694.1.4292 XP_008145273.1.99482 XP_008145274.1.99482 XP_008145279.1.99482 XP_008154018.1.99482 XP_008172416.1.60341 XP_008175324.1.60341 XP_008176482.1.60341 XP_008246691.1.1745 XP_008246697.1.1745 XP_008260674.1.1745 XP_008260678.1.1745 XP_008308955.1.100486 XP_008311573.1.100486 XP_008331675.1.100486 XP_008399080.1.1237 XP_008401839.1.1237 XP_008420767.1.1237 XP_008421210.1.1237 XP_008433322.1.1237 XP_008433324.1.1237 XP_008433483.1.1237 XP_008433489.1.1237 XP_008433494.1.1237 XP_008495030.1.100939 XP_008495149.1.100939 XP_008526338.1.77740 XP_008537623.1.77740 XP_008539388.1.77740 XP_008539395.1.77740 XP_008539407.1.77740 XP_008539410.1.77740 XP_008539714.1.77740 XP_008539715.1.77740 XP_008539758.1.77740 XP_008579882.1.73410 XP_008579884.1.73410 XP_008580590.1.73410 XP_008585842.1.73410 XP_008585847.1.73410 XP_008589681.1.73410 XP_008589682.1.73410 XP_008634733.1.15636 XP_008634736.1.15636 XP_008634738.1.15636 XP_008691177.1.72690 XP_008691189.1.72690 XP_008691225.1.72690 XP_008693978.1.72690 XP_008705243.1.72690 XP_008705244.1.72690 XP_008705245.1.72690 XP_008705247.1.72690 XP_008705248.1.72690 XP_008761668.1.100692 XP_008761670.1.100692 XP_008769992.1.100692 XP_008772221.1.4139 XP_008824849.1.79516 XP_008824865.1.79516 XP_008830091.1.79516 XP_008830110.1.79516 XP_008854265.1.79516 XP_008953276.1.60992 XP_008992077.1.60252 XP_009001542.1.60252 XP_009012267.1.102002 XP_009018938.1.102002 XP_009022236.1.102002 XP_009046156.1.39240 XP_009047427.1.39240 XP_009047566.1.39240 XP_009048211.1.39240 XP_009052120.1.39240 XP_009052549.1.39240 XP_009052737.1.39240 XP_009053070.1.39240 XP_009054643.1.39240 XP_009056374.1.39240 XP_009058901.1.39240 XP_009061370.1.39240 XP_009062586.1.39240 XP_009062588.1.39240 XP_009065732.1.39240 XP_009084845.1.15306 XP_009084849.1.15306 XP_009169225.1.43250 XP_009239774.1.23681 XP_009243271.1.23681 XP_009288336.1.47732 XP_009288337.1.47732 XP_009288344.1.47732 XP_009296456.1.45394 XP_009301164.1.45394 XP_009318340.1.49731 XP_009320522.1.49731 XP_009428446.1.37143 XP_009448911.1.37143 XP_009448968.1.37143 XP_009462254.1.38621 XP_009472820.1.38621 XP_009473262.1.38621 XP_009511707.1.22320 XP_009556906.1.62272 XP_009675848.1.43253 XP_009866097.1.31609 XP_009892672.1.48241 XP_009892676.1.48241 XP_009952282.1.99599 XP_009955444.1.99599 XP_009975982.1.11325 XP_009988188.1.11325 XP_010000736.1.85724 XP_010000744.1.85724 XP_010113760.1.88979 XP_010132697.1.100080 XP_010178063.1.17318 XP_010207239.1.23224 XP_010223172.1.20684 XP_010289459.1.48707 XP_010310054.1.13389 XP_010343416.1.74449 XP_010353241.1.97406 XP_010357659.1.97406 XP_010362906.1.97406 XP_010362978.1.97406 XP_010363144.1.97406 XP_010366761.1.97406 XP_010567514.1.12557 XP_010567520.1.12557 XP_010567524.1.12557 XP_010567526.1.12557 XP_010578193.1.12557 XP_010621017.1.5607 XP_010621293.1.5607 XP_010621298.1.5607 XP_010621315.1.5607 XP_010636723.1.5607 XP_010708118.1.16129 XP_010725971.1.16129 XP_010746617.1.61708 XP_010772376.1.77114 XP_010778403.1.77114 XP_010790873.1.77114 XP_010792996.1.77114 XP_010832334.1.44457 XP_010832335.1.44457 XP_010837042.1.44457 XP_010841723.1.44457 XP_010841726.1.44457 XP_010841732.1.44457 XP_010841741.1.44457 XP_010842995.1.44457 XP_010851425.1.44457 XP_010851977.1.44457 XP_010857023.1.44457 XP_010956829.1.22495 XP_010972455.1.22495 XP_010972473.1.22495 XP_010972489.1.22495 XP_010972496.1.22495 XP_010972502.1.22495 XP_010972513.1.22495 XP_010973016.1.51371 XP_010978464.1.51371 XP_010978470.1.51371 XP_010994986.1.51371 XP_011216219.1.58354 XP_011232961.1.58354 XP_011234696.1.58354 XP_011278010.1.62641 XP_011280374.1.62641 XP_011280375.1.62641 XP_011280379.1.62641 XP_011364636.1.92234 XP_011364640.1.92234 XP_011479048.1.28442 XP_011586051.1.59079 XP_011598886.1.59079 XP_011598892.1.59079 XP_011598896.1.59079 XP_011606035.1.43653 XP_011611357.1.43653 XP_011611358.1.43653 XP_011619481.1.43653 XP_011619489.1.43653 XP_011619811.1.43653 XP_011735025.1.29376 XP_011735026.1.29376 XP_011739971.1.29376 XP_011741072.1.29376 XP_011741073.1.29376 XP_011741078.1.29376 XP_011741088.1.29376 XP_011741089.1.29376 XP_011741095.1.29376 XP_011741100.1.29376 XP_011756518.1.29376 XP_011756523.1.29376 XP_011756527.1.29376 XP_011756555.1.29376 XP_011800314.1.43180 XP_011800322.1.43180 XP_011800323.1.43180 XP_011800338.1.43180 XP_011809602.1.43180 XP_011809605.1.43180 XP_011818220.1.43180 XP_011818221.1.43180 XP_011818236.1.43180 XP_011818247.1.43180 XP_011818253.1.43180 XP_011818260.1.43180 XP_011821819.1.47321 XP_011821823.1.47321 XP_011821828.1.47321 XP_011821829.1.47321 XP_011821840.1.47321 XP_011821855.1.47321 XP_011821856.1.47321 XP_011846184.1.47321 XP_011846185.1.47321 XP_011846599.1.47321 XP_011846635.1.47321 XP_011849827.1.47321 XP_011849829.1.47321 XP_011849830.1.47321 XP_011849831.1.47321 XP_011886929.1.92194 XP_011886930.1.92194 XP_011886936.1.92194 XP_011886945.1.92194 XP_011886946.1.92194 XP_011886952.1.92194 XP_011886957.1.92194 XP_011886958.1.92194 XP_011886959.1.92194 XP_011886960.1.92194 XP_011913876.1.92194 XP_011931485.1.92194 XP_011931486.1.92194 XP_011931505.1.92194 XP_012006291.1.54773 XP_012020669.1.54773 XP_012020681.1.54773 XP_012020684.1.54773 XP_012020686.1.54773 XP_012030712.1.66739 XP_012297534.1.9421 XP_012297535.1.9421 XP_012314009.1.9421 XP_012321314.1.9421 XP_012321315.1.9421 XP_012321751.1.9421 XP_012364479.1.23891 XP_012382621.1.11602 XP_012404132.1.9362 XP_012405109.1.9362 XP_012405111.1.9362 XP_012405112.1.9362 XP_012413430.1.4749 XP_012419188.1.74151 XP_012494084.1.63892 XP_012494085.1.63892 XP_012494086.1.63892 XP_012507632.1.63892 XP_012596789.1.48125 XP_012596792.1.48125 XP_012597461.1.48125 XP_012597462.1.48125 XP_012659992.1.62490 XP_012668228.1.62490 XP_012668245.1.62490 XP_012669858.1.3086 XP_012669859.1.3086 XP_012670474.1.3086 XP_012673331.1.3086 XP_012674489.1.3086 XP_012675285.1.3086 XP_012677957.1.3086 XP_012677958.1.3086 XP_012677959.1.3086 XP_012677964.1.3086 XP_012678828.1.3086 XP_012678918.1.3086 XP_012678919.1.3086 XP_012679093.1.3086 XP_012679094.1.3086 XP_012680508.1.3086 XP_012682541.1.3086 XP_012684487.1.3086 XP_012693428.1.3086 XP_012694474.1.3086 XP_012694739.1.3086 XP_012696390.1.3086 XP_012697381.1.3086 XP_012697425.1.3086 XP_012708876.1.37407 XP_012713983.1.37407 XP_012715596.1.37407 XP_012733759.1.37407 XP_012786155.1.84141 XP_012799030.1.65645 XP_012807210.1.11716 XP_012817505.1.99540 XP_012817506.1.99540 XP_012880565.1.60039 XP_012886783.1.60039 XP_012928609.1.39548 XP_012966030.1.91757 XP_012979221.1.91757 XP_012981124.1.91757 XP_012981139.1.91757 XP_012998343.1.53824 XP_013008683.1.53824 XP_013052084.1.65836 XP_013052119.1.65836 XP_013071657.1.17457 XP_013129005.1.78416 XP_013130408.1.78416 XP_013210190.1.66349 XP_013210194.1.66349 XP_013219125.1.77405 XP_013219126.1.77405 XP_013219127.1.77405 XP_013219128.1.77405 XP_013223413.1.63277 XP_013359252.1.28644 XP_013359253.1.28644 XP_013359254.1.28644 XP_013359255.1.28644 XP_013366897.1.28644 XP_013416048.1.76062 XP_013416049.1.76062 XP_013416063.1.76062 XP_013422140.1.76062 XP_013768636.1.53837 XP_013776728.1.66592 XP_013802655.1.3284 XP_013802656.1.3284 XP_013802657.1.3284 XP_013802658.1.3284 XP_013802660.1.3284 XP_013829533.1.57651 XP_013829534.1.57651 XP_013869475.1.33752 XP_013874652.1.33752 XP_013878177.1.33752 XP_013908940.1.67126 XP_013914333.1.67126 XP_013914334.1.67126 XP_013914338.1.67126 XP_013915320.1.67126 XP_013925619.1.67126 XP_013965996.1.84170 XP_013966113.1.84170 XP_014046901.1.97760 XP_014126650.1.73095 XP_014137109.1.10750 XP_014184904.1.24487 XP_014202588.1.60992 XP_014202589.1.60992 XP_014202590.1.60992 XP_014263259.1.88231 XP_014263889.1.88231 XP_014268796.1.88231 XP_014269088.1.88231 XP_014303299.1.53796 XP_014303300.1.53796 XP_014303302.1.53796 XP_014303412.1.53796 XP_014303908.1.53796 XP_014316720.1.53796 XP_014332604.1.15283 XP_014332615.1.15283 XP_014332616.1.15283 XP_014351756.1.90931 XP_014392557.1.60319 XP_014392558.1.60319 XP_014392559.1.60319 XP_014396230.1.60319 XP_014396231.1.60319 XP_014397408.1.60319 XP_014397411.1.60319 XP_014412660.1.101512 XP_014412661.1.101512 XP_014412663.1.101512 XP_014412692.1.101512 XP_014422721.1.101512 XP_014589732.1.31192 XP_014589733.1.31192 XP_014589776.1.31192 XP_014590044.1.31192 XP_014595304.1.31192 XP_014596072.1.31192 XP_014644185.1.5094 XP_014644186.1.5094 XP_014644188.1.5094 XP_014651788.1.5094 XP_014651790.1.5094 XP_014652906.1.5094 XP_014681483.1.89999 XP_014684675.1.49734 XP_014689704.1.49734 XP_014694463.1.49734 XP_014707056.1.49734 XP_014707057.1.49734 XP_014720927.1.49734 XP_014747927.1.99236 XP_014747928.1.99236 XP_014747929.1.99236 XP_014747932.1.99236 XP_014782086.1.24776 XP_014782546.1.24776 XP_014790250.1.24776 XP_014818896.1.91963 XP_014818897.1.91963 XP_014818899.1.91963 XP_014835037.1.96476 XP_014835415.1.96476 XP_014854841.1.96476 XP_014868146.1.96476 XP_014884699.1.100837 XP_014886129.1.100837 XP_014903908.1.100837 XP_014903956.1.100837 XP_014913914.1.100837 XP_014917218.1.86478 XP_014929236.1.86478 XP_014929238.1.86478 XP_014935760.1.86478 XP_014941944.1.86478 XP_014941945.1.86478 XP_014941946.1.86478 XP_014941947.1.86478 XP_014941948.1.86478 XP_014941950.1.86478 XP_014958047.1.66739 XP_014985056.1.72884 XP_014991215.1.72884 XP_014991217.1.72884 XP_014991219.1.72884 XP_014991221.1.72884 XP_014991254.1.72884 XP_015006678.1.72884 XP_015006906.1.72884 XP_015107226.1.17985 XP_015107249.1.17985 XP_015107252.1.17985 XP_015107253.1.17985 XP_015108294.1.60272 XP_015108324.1.60272 XP_015239402.1.42780 XP_015255308.1.42780 XP_015259134.1.42780 XP_015259770.1.42780 XP_015260487.1.42780 XP_015263448.1.55130 XP_015272951.1.55130 XP_015275047.1.55130 XP_015275048.1.55130 XP_015275053.1.55130 XP_015275930.1.55130 XP_015275931.1.55130 XP_015275944.1.55130 XP_015280667.1.55130 XP_015285901.1.63531 XP_015300301.1.63531 XP_015305257.1.63531 XP_015305258.1.63531 XP_015305274.1.63531 XP_015305275.1.63531 XP_015305282.1.63531 XP_015332481.1.40921 XP_015349619.1.40921 XP_015349620.1.40921 XP_015349649.1.40921 XP_015349650.1.40921 XP_015353676.1.40921 XP_015358523.1.40921 XP_015395999.1.5354 XP_015396161.1.5354 XP_015414184.1.95426 XP_015427277.1.95426 XP_015665996.1.16292 XP_015665997.1.16292 XP_015672282.1.16292 XP_015672393.1.16292 XP_015678127.1.16292 XP_015678745.1.16292 XP_015678751.1.16292 XP_015681934.1.16292 XP_015686319.1.16292 XP_015715316.1.68032 XP_015715747.1.68032 XP_015715759.1.68032 XP_015794349.1.93521 XP_015795883.1.93521 XP_015795893.1.93521 XP_015796693.1.37898 XP_015812030.1.37898 XP_015812036.1.37898 XP_015824762.1.37898 XP_015824775.1.37898 XP_015824785.1.37898 XP_015824798.1.37898 XP_015831772.1.37898 XP_015842143.1.50099 XP_015842144.1.50099 XP_015862819.1.50099 XP_015913118.1.5422 XP_015978359.1.101085 XP_015989274.1.101085 XP_015989287.1.101085 XP_015989300.1.101085 XP_015989389.1.101085 XP_016048660.1.11023 XP_016071774.1.3490 XP_016071775.1.3490 XP_016071776.1.3490 XP_016075787.1.3490 XP_016075788.1.3490 XP_016082088.1.37387 XP_016094083.1.42290 XP_016094084.1.42290 XP_016094085.1.42290 XP_016111193.1.42290 XP_016116781.1.42290 XP_016116901.1.42290 XP_016119142.1.42290 XP_016120170.1.42290 XP_016120616.1.42290 XP_016121232.1.42290 XP_016121711.1.42290 XP_016122209.1.42290 XP_016130507.1.42290 XP_016161411.1.66865 XP_016161412.1.66865 XP_016284623.1.35504 XP_016284624.1.35504 XP_016300314.1.79318 XP_016303663.1.79318 XP_016315150.1.79318 XP_016315151.1.79318 XP_016322520.1.79318 XP_016339324.1.79318 XP_016349671.1.79318 XP_016350017.1.79318 XP_016350018.1.79318 XP_016351542.1.79318 XP_016360602.1.79318 XP_016369996.1.44103 XP_016375808.1.44103 XP_016377455.1.44103 XP_016382108.1.44103 XP_016385118.1.44103 XP_016391203.1.44103 XP_016404468.1.44103 XP_016408056.1.44103 XP_016414871.1.44103 XP_016414872.1.44103 XP_016416990.1.44103 XP_016528776.1.10163 XP_016810521.1.37143 XP_016810558.1.37143 XP_016810559.1.37143 XP_016810560.1.37143 XP_016828440.1.28591 XP_016830965.1.69978 XP_016832683.1.69978 XP_017165777.1.1237 XP_017200436.1.1745 XP_017200437.1.1745 XP_017209641.1.45394 XP_017209642.1.45394 XP_017209670.1.45394 XP_017260937.1.84151 XP_017278613.1.84151 XP_017294938.1.84151 XP_017294939.1.84151 XP_017296162.1.84151 XP_017307302.1.5077 XP_017317761.1.5077 XP_017317990.1.5077 XP_017318147.1.5077 XP_017318160.1.5077 XP_017318211.1.5077 XP_017318254.1.5077 XP_017318280.1.5077 XP_017318360.1.5077 XP_017318364.1.5077 XP_017318369.1.5077 XP_017318453.1.5077 XP_017331187.1.5077 XP_017375488.1.71028 XP_017376426.1.71028 XP_017376850.1.71028 XP_017376852.1.71028 XP_017383880.1.71028 XP_017460861.1.95384 XP_017483265.1.95384 XP_017492774.1.95384 XP_017492835.1.95384 XP_017494517.1.95384 XP_017501841.1.32401 XP_017501842.1.32401 XP_017501843.1.32401 XP_017520885.1.32401 XP_017520893.1.32401 XP_017529325.1.32401 XP_017545066.1.86671 XP_017545619.1.86671 XP_017545626.1.86671 XP_017545633.1.86671 XP_017545893.1.86671 XP_017564760.1.86671 XP_017593296.1.15636 XP_017653326.1.79516 XP_017653329.1.79516 XP_017704650.1.44346 XP_017704651.1.44346 XP_017704684.1.44346 XP_017715478.1.44346 XP_017728949.1.44346 XP_017728959.1.44346 XP_017728967.1.44346 XP_017728972.1.44346 XP_017728977.1.44346 XP_017728986.1.44346 XP_017728996.1.44346 XP_017826324.1.60252 XP_017826325.1.60252 XP_017903937.1.57651 XP_017935676.1.51550 XP_017935677.1.51550 XP_017935679.1.51550 XP_017935691.1.51550 XP_017945705.1.99540 XP_017948267.1.99540 XP_017948268.1.99540 XP_017948269.1.99540 XP_017952915.1.99540 XP_018095104.1.7800 XP_018095605.1.7800 XP_018095606.1.7800 XP_018096302.1.7800 XP_018097458.1.7800 XP_018098137.1.7800 XP_018118237.1.7800 XP_018120359.1.7800 XP_018120360.1.7800 XP_018426047.1.44173 XP_018426134.1.44173 XP_018430417.1.44173 XP_018495584.1.18380 XP_018496130.1.18380 XP_018496132.1.18380 XP_018496207.1.18380 XP_018496208.1.18380 XP_018496209.1.18380 XP_018496212.1.18380 XP_018496217.1.18380 XP_018497501.1.18380 XP_018517457.1.34915 XP_018522697.1.34915 XP_018522754.1.34915 XP_018527033.1.34915 XP_018542511.1.34915 XP_018542515.1.34915 XP_018555966.1.34915 XP_018555968.1.34915 XP_018558358.1.34915 XP_018558359.1.34915 XP_018558894.1.34915 XP_018587871.1.37976 XP_018587872.1.37976 XP_018587873.1.37976 XP_018599497.1.37976 XP_018601715.1.37976 XP_018606667.1.37976 XP_018606670.1.37976 XP_018647781.1.29077 XP_018647788.1.29077 XP_018647790.1.29077 XP_018765586.1.15306 XP_018765587.1.15306 XP_018765588.1.15306 XP_018765589.1.15306 XP_018864936.1.27298 XP_018921732.1.5815 XP_018923865.1.5815 XP_018925800.1.5815 XP_018927393.1.5815 XP_018928100.1.5815 XP_018932260.1.5815 XP_018932527.1.5815 XP_018935509.1.5815 XP_018935510.1.5815 XP_018940480.1.5815 XP_018941531.1.5815 XP_018944544.1.5815 XP_018944624.1.5815 XP_018948347.1.5815 XP_018951437.1.5815 XP_018951438.1.5815 XP_018951439.1.5815 XP_018951441.1.5815 XP_018958614.1.5815 XP_018958616.1.5815 XP_018958617.1.5815 XP_018958618.1.5815 XP_018958620.1.5815 XP_018958621.1.5815 XP_018958622.1.5815 XP_018958624.1.5815 XP_018960259.1.5815 XP_018960263.1.5815 XP_018961745.1.5815 XP_018963486.1.5815 XP_018963820.1.5815 XP_018963821.1.5815 XP_018972649.1.5815 XP_018972650.1.5815 XP_018976515.1.5815 XP_018980950.1.5815 XP_019113500.1.61708 XP_019206828.1.78416 XP_019209876.1.78416 XP_019280712.1.44245 XP_019280748.1.44245 XP_019280749.1.44245 XP_019280750.1.44245 XP_019280751.1.44245 XP_019280752.1.44245 XP_019280753.1.44245 XP_019280754.1.44245 XP_019280756.1.44245 XP_019280762.1.44245 XP_019288620.1.44245 XP_019307596.1.44245 XP_019336415.1.47583 XP_019342108.1.47583 XP_019370491.1.87953 XP_019370492.1.87953 XP_019372241.1.87953 XP_019400705.1.79039 XP_019466984.1.16129 XP_019486829.1.44202 XP_019486831.1.44202 XP_019486832.1.44202 XP_019486833.1.44202 XP_019486834.1.44202 XP_019486839.1.44202 XP_019569761.1.88060 XP_019569763.1.88060 XP_019569764.1.88060 XP_019569766.1.88060 XP_019621880.1.58950 XP_019624359.1.58950 XP_019628149.1.58950 XP_019644218.1.58950 XP_019645065.1.58950 XP_019645071.1.58950 XP_019645081.1.58950 XP_019645091.1.58950 XP_019663400.1.58354 XP_019664694.1.58354 XP_019664827.1.58354 XP_019687262.1.62641 XP_019715067.1.30352 XP_019719905.1.30352 XP_019722311.1.30352 XP_019748137.1.30352 XP_019750478.1.30352 XP_019750490.1.30352 XP_019800477.1.83887 XP_019800479.1.83887 XP_019800480.1.83887 XP_019800706.1.83887 XP_019800707.1.83887 XP_019800708.1.83887 XP_019812192.1.53367 XP_019817074.1.53367 XP_019840867.1.53367 XP_019841113.1.53367 XP_019841114.1.53367 XP_019841117.1.53367 XP_019841118.1.53367 XP_019841119.1.53367 XP_019919685.1.10878 XP_020006760.1.5219 XP_020009057.1.5219 XP_020009065.1.5219 XP_020009071.1.5219 XP_020009073.1.5219 XP_020016055.1.5219 XP_020324928.1.87700 XP_020365220.1.65276 XP_020369399.1.65276 XP_020370504.1.65276 XP_020382252.1.65276 XP_020382253.1.65276 XP_020383649.1.65276 XP_020383651.1.65276 XP_020383653.1.65276 XP_020383660.1.65276 XP_020383662.1.65276 XP_020385995.1.65276 XP_020386117.1.65276 XP_020386798.1.65276 XP_020386885.1.65276 XP_020387039.1.65276 XP_020387215.1.65276 XP_020387218.1.65276 XP_020387286.1.65276 XP_020387309.1.65276 XP_020387381.1.65276 XP_020387395.1.65276 XP_020387534.1.65276 XP_020388684.1.65276 XP_020390688.1.65276 XP_020390805.1.65276 XP_020443000.1.23826 XP_020443001.1.23826 XP_020444623.1.23826 XP_020445135.1.23826 XP_020481863.1.8198 XP_020482141.1.8198 XP_020482230.1.8198 XP_020493427.1.8198 XP_020494152.1.8198 XP_020494155.1.8198 XP_020494156.1.8198 XP_020494166.1.8198 XP_020494772.1.8198 XP_020494806.1.8198 XP_020511857.1.8198 XP_020511995.1.8198 XP_020511996.1.8198 XP_020514142.1.8198 XP_020514269.1.8198 XP_020514659.1.8198 XP_020514661.1.8198 XP_020516000.1.8198 XP_020516486.1.8198 XP_020634799.1.8467 XP_020641895.1.8467 XP_020654603.1.8467 XP_020654604.1.8467 XP_020654605.1.8467 XP_020665179.1.8467 XP_020665184.1.8467 XP_020666160.1.8467 XP_020727382.1.74333 XP_020742258.1.74333 XP_020742260.1.74333 XP_020742261.1.74333 XP_020742262.1.74333 XP_020742307.1.74333 XP_020743264.1.74333 XP_020755546.1.74333 XP_020773035.1.12261 XP_020774875.1.12261 XP_020774876.1.12261 XP_020776181.1.12261 XP_020776282.1.12261 XP_020780586.1.12261 XP_020780588.1.12261 XP_020784580.1.12261 XP_020784917.1.12261 XP_020788636.1.12261 XP_020795379.1.12261 XP_020836141.1.61212 XP_020859736.1.61212 XP_020945589.1.46622 XP_020954087.1.46622 XP_020954094.1.46622 XP_020955506.1.46622 XP_020955508.1.46622 XP_020955509.1.46622 XP_021052794.1.100879 XP_021071329.1.100879 XP_021071390.1.100879 XP_021071391.1.100879 XP_021071629.1.100879 XP_021071630.1.100879 XP_021071631.1.100879 XP_021071773.1.100879 XP_021231420.1.32913 XP_021231549.1.32913 XP_021231675.1.32913 XP_021272492.1.32913 XP_021326437.1.45394 XP_021333749.1.45394 XP_021408535.1.53032 XP_021424020.1.32639 XP_021447776.1.32639 XP_021499968.1.76796 XP_021500544.1.76796 XP_021500545.1.76796 XP_021506227.1.76796 XP_021511763.1.76796 XP_021511764.1.76796 XP_021511765.1.76796 XP_021511768.1.76796 XP_021511769.1.76796 XP_021527628.1.9421 XP_021543743.1.83697 XP_021546282.1.83697 XP_021552525.1.83697 XP_021552531.1.83697 XP_021586431.1.77405 XP_021590096.1.77405 XP_022043209.1.10920 XP_022077125.1.10920 XP_022078715.1.10920 XP_425458.2.86415 XP_513765.1.37143 XP_543797.2.84170 XP_578415.4.100692 XP_605163.2.59421 XP_688877.2.45394 XP_874074.1.59421 Sakowv30005480m Sakowv30006304m Sakowv30006305m Sakowv30006307m Sakowv30006340m Sakowv30006342m Sakowv30006343m Sakowv30015343m Sakowv30015345m Sakowv30023489m Sakowv30023490m Sakowv30023494m Sakowv30023497m Sakowv30026016m Sakowv30026045m Sakowv30042129m ENSVPAP00000003981 ENSVPAP00000003982 ENSVPAP00000007652 ENSVPAP00000011664 ENSVPAP00000011721 ENSVPAP00000011796 ENSPCAP00000002399 ENSPCAP00000011015 ENSPCAP00000013208 ENSPCAP00000014871 ENSPCAP00000016064 ENSCHOP00000003815 ENSCHOP00000004732 ENSCHOP00000006436 ENSCHOP00000007328 ENSCHOP00000009065 ENSCHOP00000009485 ENSCHOP00000011554 ENSMEUP00000001254 ENSMEUP00000002898 ENSMEUP00000003595 ENSMEUP00000008941 ENSMEUP00000010573 ENSMEUP00000010575 ENSMEUP00000013088 ENSMEUP00000014319 ENSMGAP00000016644 ENSMGAP00000016645 ENSMGAP00000016651 ENSPTRP00000008064 ENSPTRP00000030386 ENSPTRP00000030387 ENSPTRP00000030393 ENSPTRP00000030447 ENSPTRP00000030448 ENSPTRP00000050485 ENSPTRP00000056593 ENSGACP00000000349 ENSGACP00000000567 ENSGACP00000001626 ENSGACP00000001644 ENSGACP00000001659 ENSGACP00000002671 ENSGACP00000002703 ENSGACP00000002721 ENSGACP00000003371 ENSGACP00000003380 ENSGACP00000003537 ENSGACP00000003542 ENSGACP00000003570 ENSGACP00000003576 ENSGACP00000003693 ENSGACP00000003714 ENSGACP00000003730 ENSGACP00000018374 ENSGACP00000018382 ENSGACP00000018399 ENSGACP00000019637 ENSECAP00000001598 ENSECAP00000001742 ENSECAP00000002229 ENSECAP00000002344 ENSECAP00000002796 ENSECAP00000003055 ENSECAP00000003604 ENSECAP00000004124 ENSECAP00000004479 ENSECAP00000005357 ENSECAP00000005553 ENSECAP00000005600 ENSECAP00000005877 ENSP00000289352 ENSP00000343282 ENSP00000346316 ENSP00000347168 ENSP00000348258 ENSP00000350159 ENSP00000350767 ENSP00000352980 ENSP00000353624 ENSP00000358153 ENSP00000358162 ENSP00000366581 ENSP00000366956 ENSP00000366974 ENSP00000367034 ENSP00000376663 ENSP00000376664 ENSP00000376668 ENSP00000376669 ENSP00000443017 ENSP00000462355 ENSP00000462667 ENSP00000476824 ENSTTRP00000004799 ENSTTRP00000012764 ENSTTRP00000012771 ENSTTRP00000014915 ENSTTRP00000015864 ENSTTRP00000015874 ENSTTRP00000015883 ENSTTRP00000015891 ENSTTRP00000015900 ENSOPRP00000001115 ENSOPRP00000001125 ENSOPRP00000003314 ENSOPRP00000007715 ENSOPRP00000011474 ENSOPRP00000011506 ENSOPRP00000012824 ENSOPRP00000012843 ENSXETP00000001377 ENSXETP00000044316 ENSXETP00000054182 ENSXETP00000054185 ENSXETP00000054589 ENSXETP00000054958 ENSXETP00000055001 ENSXETP00000055237 ENSXETP00000055544 ENSXETP00000056117 ENSXETP00000056585 ENSXETP00000056587 ENSXETP00000056849 ENSXETP00000056865 ENSXETP00000056866 ENSXETP00000056870 ENSXETP00000056873 ENSXETP00000056877 ENSXETP00000056881 ENSXETP00000056888 ENSXETP00000056892 ENSXETP00000056935 ENSXETP00000057375 ENSXETP00000058765 ENSXETP00000058860 ENSXETP00000058936 ENSXETP00000059040 ENSXETP00000059551 ENSXETP00000059940 ENSXETP00000060763 ENSXETP00000060942 ENSXETP00000061001 ENSXETP00000061007 ENSXETP00000061040 ENSXETP00000061355 ENSXETP00000061494 ENSXETP00000061740 ENSXETP00000061885 ENSXETP00000062175 ENSXETP00000062199 ENSXETP00000062223 ENSXETP00000062225 ENSXETP00000062375 ENSXETP00000062392 ENSXETP00000062836 ENSXETP00000063397 ENSXETP00000063763 Aqu1.205686|PACid:15704214 TRIUR3_25662-P1 ENSBTAP00000029245 ENSBTAP00000033280 ENSBTAP00000033281 ENSBTAP00000033288 ENSBTAP00000042409 ENSBTAP00000042428 ENSBTAP00000042460 ENSBTAP00000042466 ENSBTAP00000042467 ENSBTAP00000047761 ENSBTAP00000052235 ENSBTAP00000053034 ENSBTAP00000054635 ENSSHAP00000002157 ENSSHAP00000003533 ENSSHAP00000003584 ENSSHAP00000004046 ENSSHAP00000005562 ENSSHAP00000022186 ENSSHAP00000022198 ENSGALP00000037288 ENSGALP00000037295 ENSGALP00000037308 ENSGALP00000037318 ENSCAFP00000019126 ENSCAFP00000033563 ENSCAFP00000034229 ENSCAFP00000036545 ENSCAFP00000037324 ENSCAFP00000037435 ENSCAFP00000038752 ENSCAFP00000040694 ENSCAFP00000042617 ENSCAFP00000043106 ENSLAFP00000004522 ENSLAFP00000016306 ENSLAFP00000018530 ENSLAFP00000019408 ENSLAFP00000022732 ENSLAFP00000022963 ENSLAFP00000027938 ENSLAFP00000027955 ENSTTRP00000004799 ENSTTRP00000012764 ENSTTRP00000012771 ENSTTRP00000014915 ENSTTRP00000015864 ENSTTRP00000015874 ENSTTRP00000015883 ENSTTRP00000015891 ENSTTRP00000015900 ENSFCAP00000005545 ENSFCAP00000006288 ENSFCAP00000009377 ENSFCAP00000009541 ENSFCAP00000010044 ENSFCAP00000012992 ENSGACP00000000349 ENSGACP00000000567 ENSGACP00000001626 ENSGACP00000001644 ENSGACP00000001659 ENSGACP00000002671 ENSGACP00000002703 ENSGACP00000002721 ENSGACP00000003371 ENSGACP00000003380 ENSGACP00000003537 ENSGACP00000003542 ENSGACP00000003570 ENSGACP00000003576 ENSGACP00000003693 ENSGACP00000003714 ENSGACP00000003730 ENSGACP00000018374 ENSGACP00000018382 ENSGACP00000018399 ENSGACP00000019637 ENSDARP00000077832 ENSDARP00000082327 ENSDARP00000101311 ENSDARP00000101467 ENSDARP00000101862 ENSDARP00000104379 ENSDARP00000105059 ENSDARP00000105168 ENSDARP00000105496 ENSDARP00000106245 ENSDARP00000106443 ENSDARP00000106496 ENSDARP00000106634 ENSDARP00000107028 ENSDARP00000107148 ENSDARP00000107547 ENSDARP00000107585 ENSDARP00000107946 ENSDARP00000107998 ENSDARP00000109044 ENSDARP00000109071 ENSDARP00000109257 ENSDARP00000109299 ENSDARP00000109355 ENSDARP00000110935 ENSDARP00000111175 ENSDARP00000111526 ENSDARP00000111786 ENSDARP00000111930 ENSDARP00000112034 ENSDARP00000129044 ENSPVAP00000014487 ENSPVAP00000015564 ENSPVAP00000015566 ENSPVAP00000016600 ENSPVAP00000016609 ENSPVAP00000016619 ENSPVAP00000016937 ENSPVAP00000016996 ENSPVAP00000017026 ENSOPRP00000001115 ENSOPRP00000001125 ENSOPRP00000003314 ENSOPRP00000007715 ENSOPRP00000011474 ENSOPRP00000011506 ENSOPRP00000012824 ENSOPRP00000012843 ENSSTOP00000015496 ENSSTOP00000016311 ENSSTOP00000016356 ENSSTOP00000016752 ENSSTOP00000019588 ENSSTOP00000020326 ENSSTOP00000020366 ENSSTOP00000020581 ENSSTOP00000022899 ENSPANP00000000138 ENSPANP00000006953 ENSPANP00000008518 ENSOARP00000013467 ENSOARP00000021764 ENSMLUP00000000054 ENSMLUP00000017704 ENSMLUP00000020187 ENSMLUP00000022116 ENSMLUP00000022553 ENSRNOP00000039602 ENSRNOP00000041042 ENSRNOP00000064783 ENSRNOP00000065233 ENSRNOP00000066550 ENSRNOP00000066622 ENSRNOP00000066653 ENSRNOP00000066669 ENSRNOP00000066695 ENSRNOP00000067176 ENSRNOP00000067494 ENSRNOP00000067502 ENSRNOP00000067813 ENSPPYP00000001075 ENSPPYP00000004934 ENSPPYP00000018228 ENSPPYP00000018229 ENSPPYP00000018235 ENSPPYP00000018242 ENSPPYP00000018245 ENSPPYP00000018249 ENSPPYP00000018255 ENSPPYP00000018269 ENSPPYP00000018279 ENSPPYP00000018280 ENSPPYP00000018285 ENSPPYP00000019358 ENSMODP00000004700 ENSSARP00000001853 ENSSARP00000001905 ENSSARP00000003763 ENSSARP00000004390 ENSSARP00000008069 ENSSARP00000009373 ENSSARP00000009376 ENSSARP00000012117 ENSGGOP00000006237 ENSGGOP00000018935 ENSGGOP00000019841 ENSGGOP00000020335 ENSGGOP00000020625 ENSGGOP00000021745 ENSGGOP00000021754 ENSGGOP00000024364 ENSGGOP00000027594 ENSMICP00000000255 ENSMICP00000005483 ENSMICP00000005492 ENSMICP00000007507 ENSMICP00000007693 ENSMICP00000010567 ENSMICP00000015726 Smp_053290 Smp_053300 Smp_053390 Smp_194870 ENSTRUP00000003007 ENSTRUP00000003756 ENSTRUP00000003881 ENSTRUP00000003956 ENSTRUP00000004758 ENSTRUP00000006859 ENSTRUP00000009756 ENSTRUP00000010470 ENSTRUP00000022836 ENSTRUP00000029439 ENSTRUP00000039554 ENSTRUP00000039742 ENSLAFP00000004522 ENSLAFP00000016306 ENSLAFP00000018530 ENSLAFP00000019408 ENSLAFP00000022732 ENSLAFP00000022963 ENSLAFP00000027938 ENSLAFP00000027955 ENSGMOP00000004141 ENSGMOP00000021197 ENSGMOP00000021199 ENSGMOP00000021203 ENSGMOP00000021245 ENSGMOP00000021373 ENSGMOP00000021416 ENSGMOP00000021433 ENSGMOP00000021501 ENSGMOP00000021502 ENSGMOP00000021522 ENSGMOP00000021539 ENSGMOP00000021648 ENSGMOP00000021775 ENSGMOP00000021875 ENSGMOP00000021876 ENSGMOP00000021921 ENSGMOP00000021974 ENSGMOP00000022012 ENSGMOP00000022061 jgi|Lotgi1|145439|e_gw1.324.28.1 jgi|Lotgi1|146028|e_gw1.619.24.1 jgi|Lotgi1|146029|e_gw1.619.16.1 jgi|Lotgi1|146923|e_gw1.1414.5.1 jgi|Lotgi1|147261|e_gw1.2197.5.1 jgi|Lotgi1|147329|e_gw1.2263.9.1 jgi|Lotgi1|147488|e_gw1.2736.27.1 jgi|Lotgi1|147781|e_gw1.4384.7.1 jgi|Lotgi1|148042|e_gw1.5500.6.1 jgi|Lotgi1|148724|e_gw1.11879.2.1 jgi|Lotgi1|148824|e_gw1.13009.3.1 jgi|Lotgi1|148840|e_gw1.13327.3.1 jgi|Lotgi1|176226|fgenesh2_pg.C_sca_829000003 jgi|Lotgi1|176527|fgenesh2_pg.C_sca_2012000001 jgi|Lotgi1|202861|estExt_Genewise1.C_sca_21100002 ENSONIP00000026073 ENSTBEP00000001747 ENSTBEP00000004385 ENSTBEP00000010838 ENSTBEP00000013104 ENSMMUP00000001926 ENSMMUP00000001935 ENSMMUP00000005840 ENSMMUP00000012596 ENSMMUP00000031247 ENSMMUP00000031248 ENSMMUP00000031273 ENSMMUP00000034283 ENSMMUP00000034308 ENSMMUP00000034312 ENSMMUP00000034321 ENSMMUP00000040172 ENSMLUP00000000054 ENSMLUP00000017704 ENSMLUP00000020187 ENSMLUP00000022116 ENSMLUP00000022553 ENSMGAP00000016644 ENSMGAP00000016645 ENSMGAP00000016651 ENSVPAP00000003981 ENSVPAP00000003982 ENSVPAP00000007652 ENSVPAP00000011664 ENSVPAP00000011721 ENSVPAP00000011796 jgi|Capca1|103539|e_gw1.30197.3.1 jgi|Capca1|104225|e_gw1.18543.6.1 jgi|Capca1|113150|e_gw1.96.77.1 jgi|Capca1|128650|e_gw1.3556.3.1 jgi|Capca1|137816|e_gw1.10563.9.1 jgi|Capca1|143645|e_gw1.7.33.1 jgi|Capca1|146051|e_gw1.340.52.1 jgi|Capca1|157638|estExt_Genewise1.C_560091 jgi|Capca1|178734|estExt_Genewise1Plus.C_740057 jgi|Capca1|184022|estExt_Genewise1Plus.C_4690017 jgi|Capca1|203393|fgenesh1_pg.C_scaffold_13000067 jgi|Capca1|213178|fgenesh1_pg.C_scaffold_1096000003 jgi|Capca1|213300|fgenesh1_pg.C_scaffold_23000070 jgi|Capca1|90262|e_gw1.163.105.1 jgi|Capca1|90469|e_gw1.20263.1.1 jgi|Capca1|96390|e_gw1.9549.5.1 jgi|Capca1|97484|e_gw1.41553.6.1 jgi|Capca1|97619|e_gw1.2980.11.1 gi|109157557|gb|2F8N_B| gi|109157560|gb|2F8N_F| gi|148228507|ref|NP_001087926| gi|214275|gb|AAA49761| gi|214280|gb|AAA49766| gi|214286|gb|AAA49771| gi|50604163|gb|AAH78038| gi|51317335|sp|P62799| gi|64765|gb|CAA25042| gi|64768|gb|CAA26809| gi|64773|gb|CAA26814| gi|64779|gb|CAA26819| SSCA001253-PA SSCA005216-PA SSCA005746-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]