SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000062282 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000062282
Domain Number 1 Region: 199-333
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-43
Family Third domain of FERM 0.000000381
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 9.03e-39
Family Second domain of FERM 0.000000989
Further Details:      
 
Domain Number 3 Region: 494-581
Classification Level Classification E-value
Superfamily Moesin tail domain 2.75e-32
Family Moesin tail domain 0.00000894
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.68e-26
Family First domain of FERM 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000062282   Gene: ENSXETG00000009770   Transcript: ENSXETT00000061897
Sequence length 581
Comment pep:known scaffold:JGI_4.2:GL172875.1:1127156:1176824:-1 gene:ENSXETG00000009770 transcript:ENSXETT00000061897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLK
LNKKVTAQDVRKDSPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPE
TAVLLASYAVQAKYGDYNKECQKPGYLSGDKLLPQRVLEQHKLSKDQWEERIHVWHEEHR
GMLREDAILEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQMESDETSLTEPKRLAAPYLHDSIKYLLDDIVMERLRQIEDQTR
KAQEALEEQTRKALELEDERRRAQEEAEKLARERLAAEEAKEALLKQSQDQMKNQEHLAA
ELSALTATISQLEFARQKKELEAQEWQDKAHNVQADLEKTQEELKLVMTTPHVPEPVHAE
NEHDDEDNENNAEASAELKSEAMIKDRSEEDRTTEAEKNERVQKHLLLLSSELANARDET
KKTANDLLHAENVRAGRDKYKTLRQIRQGNTKQRIDEFESM
Download sequence
Identical sequences F6Y851
ENSXETP00000021526 ENSXETP00000062282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]