SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000063504 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000063504
Domain Number 1 Region: 198-289
Classification Level Classification E-value
Superfamily TAFH domain-like 3.4e-34
Family TAFH domain-like 0.0000248
Further Details:      
 
Domain Number 2 Region: 572-619
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000000188
Family TBP-associated factors, TAFs 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000063504   Gene: ENSXETG00000032722   Transcript: ENSXETT00000065345
Sequence length 783
Comment pep:known_by_projection scaffold:JGI_4.2:GL173320.1:97485:144339:1 gene:ENSXETG00000032722 transcript:ENSXETT00000065345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLSKVAPVLVTSQATKVRGGPRMPAPQQVMASKAPQTTAIQIPAGKESSPAQAISGSERG
PASVITSSLTSSLAKVTSSMGSRQNAPVSLPAVVRICTPSSASSVSATGSVVIPANSVMG
PGTSSITVLPISASTPVITPITINTCTSSVIPSASVTPSVSQNPIRSSLSASVRTTTPSS
IPSVKIETQVNVYCGVQEEILDNVKKCKNFLATLIKLASSGPQSPTMGQNVKNLVKSLLD
SDIEPEEFTAKLYKELKSSPQPYLVPFLKKSLPALRQLMPNSQEFIMQCGQQTPQPPANN
SISLVKSTPTFSLQAGKQIGSTIGNAKFQQTTSATTKPIGTVKTVNIKQVVPSAGLYEST
TGPGALFTFIVCNPLSTISCANHCVVGAEATVQLLGGTWHIAIRLPSAIPCCVCMGITCR
KPFVNATAVHVKLHRVRPVCLKGLEPSGQVYVVLQQQSPGGNLKQVSLSQNSTLTIQKPG
ENRVSLNALIQASHLPPGSILKQITIPGNKVISVQAAPLHIKESGTSFREEDDINDVTSM
AGVNLSEESACILAANSELVGAVIRSCKDEPFLFTSALQNRILDIGKRHDIKELNSDVMN
LVSHATQERLRGLIEKLTLAAQHRSTNYKQSDRYLKYSDVRAQLKFLEQLEHLEKQRRNE
EEREMLLRAAKSRSNREDPEQLRLKQKAKEDYVVKQTSLKMYYAANGCLYMTKVVGPQKK
RILPCGSQGQITNTIPSGSTIFGLSKSLLVPRITRVSLRDLIFCMEQERESKHSLSLYRA
LLK
Download sequence
Identical sequences F7EHC8
ENSXETP00000063504 ENSXETP00000063504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]