SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428769036|ref|YP_007160826.1| from Cyanobacterium aponinum PCC 10605

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428769036|ref|YP_007160826.1|
Domain Number 1 Region: 3-114
Classification Level Classification E-value
Superfamily RbcX-like 5.23e-40
Family RbcX-like 0.0000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428769036|ref|YP_007160826.1|
Sequence length 137
Comment chaperonin family protein RbcX [Cyanobacterium aponinum PCC 10605]
Sequence
MSYKQIAKDTAKVLQSYLTFQAVKIIINQLTETNPRQAIWLTNYSDRTSVQDSEKYLNNL
LGENKELVLRILTVREDLAEQVLEFLPEMVKTNIIQSNIEHRRHLLERLTQTQSLPVNSS
DKDENNQESNSLDNKEE
Download sequence
Identical sequences A0A2G3P927 K9Z232
gi|428769036|ref|YP_007160826.1| WP_015218513.1.72445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]