SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|122879338|ref|YP_202942.6| from Xanthomonas oryzae pv. oryzae KACC 10331

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|122879338|ref|YP_202942.6|
Domain Number 1 Region: 98-379
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.39e-67
Family RecA protein-like (ATPase-domain) 0.0000000157
Further Details:      
 
Domain Number 2 Region: 58-131
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.83e-25
Family Cold shock DNA-binding domain-like 0.0000831
Further Details:      
 
Domain Number 3 Region: 9-54
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000000471
Family Rho termination factor, N-terminal domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|122879338|ref|YP_202942.6|
Sequence length 426
Comment transcription termination factor Rho [Xanthomonas oryzae pv. oryzae KACC 10331]
Sequence
MPEGFPVYSLSDLKRMPAQKLLDIADQLNIQEGVARARKQDVIFALLKVLTRHGEGVAAD
GVLEILPDGFGFLRAAEASYLAGPDDTYISPSQIRRFNLRTGDHLSGRIRFPKDGERYFA
LSIVDTINGEPLEASKGKVLFENLTPLFPRRRFRLERGDGSTEDITGRILDLMAPQGKGQ
RALIVSPPKAGKTMMMQQVATAITTNHPEVHMIVLLIDERPEEVTEMQRTVRGEVISSTF
DEPAARHVQVAEMVIERAKRLVEHKKDVVILLDSITRLARAYNNVVPSSGKVLTGGVDAN
ALHRPKRFFGAARNVEEGGSLTVIATALVETGSKMDEVIYEEFKGTGNSEVHLNRRITEK
RVYPAIDINRSGTRREDLLIEPELLQKIWILRKLLHPMDEIAAMEFLLDKMKTTKSNDEF
FSSMKR
Download sequence
Identical sequences gi|84625714|ref|YP_453086.1| 291331.XOO4303 342109.XOO_4057 gi|122879338|ref|YP_202942.6|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]