SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000000210 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000000210
Domain Number 1 Region: 22-278
Classification Level Classification E-value
Superfamily Carbonic anhydrase 8.24e-84
Family Carbonic anhydrase 0.00000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000000210   Gene: ENSPTRG00000000111   Transcript: ENSPTRT00000000250
Sequence length 307
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:8966776:8997045:1 gene:ENSPTRG00000000111 transcript:ENSPTRT00000000250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALVLLLSLFLLGGQAQHGSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYN
PSLKGLNLTGYETQAGEFPMVNNGHTVQISLPSTMRMTAADGTVYIAQQMHFHWGGASSD
ISGSEHTVDGIRHVIEIHVVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNF
ISHLANIKYPGQRTTLTGLDIQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLS
RTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLRKIEELD
YLRRALN
Download sequence
Identical sequences ENSPTRP00000000210 ENSPTRP00000000210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]