SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000000256 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000000256
Domain Number 1 Region: 6-88
Classification Level Classification E-value
Superfamily Histone-fold 6.98e-16
Family TBP-associated factors, TAFs 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000000256   Gene: ENSPTRG00000000130   Transcript: ENSPTRT00000000298
Sequence length 138
Comment pep:known chromosome:CHIMP2.1.4:1:10550732:10563462:1 gene:ENSPTRG00000000130 transcript:ENSPTRT00000000298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEEAETEEQQRFSYQQRLKAAVHYTVGCLCEEVALDKEMQFSKQTIAAISELTFRQCEN
FAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQINLERKAQKKKKSGD
GSKNSKQPAEAGVVESEN
Download sequence
Identical sequences H2PXZ6
NP_001191821.1.37143 XP_003822141.1.60992 XP_003822142.1.60992 XP_008973871.1.60992 ENSPTRP00000000256 ENSPTRP00000000256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]