SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000000760 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000000760
Domain Number 1 Region: 56-128
Classification Level Classification E-value
Superfamily Histone-fold 2.7e-23
Family TBP-associated factors, TAFs 0.000042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000000760   Gene: ENSPTRG00000000437   Transcript: ENSPTRT00000000848
Sequence length 161
Comment pep:known chromosome:CHIMP2.1.4:1:28641305:28682336:-1 gene:ENSPTRG00000000437 transcript:ENSPTRT00000000848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTTVVKIPGTPGTGGRLSPENNQVLTK
KKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHL
ERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK
Download sequence
Identical sequences A0A0D9S807 A0A287D799 A0A2I3RRS5 A0A2J8Y5L8 A0A2K5ERS7 A0A2K5SF54 A0A2K5Y5I2 A0A2K6FFM0 A0A2K6JQB9 A0A2K6NRX3 E2QVZ3 F6TWH6 F7HKI7 G1LY35 G1RFH7 G3H1Y6 G3QZQ5 G8F4R0 I3LKU2 M3WQ01
ENSPTRP00000000760 ENSPCAP00000005112 ENSSARP00000006850 ENSCJAP00000017863 ENSCAFP00000040836 ENSMMUP00000007585 ENSSARP00000006850 NP_001273972.1.84170 XP_001153380.1.37143 XP_002716122.1.1745 XP_003271760.1.23891 XP_003271761.1.23891 XP_003415489.1.64505 XP_003498423.1.69978 XP_003989820.1.62641 XP_004025361.1.27298 XP_004266629.1.21590 XP_004377084.1.4749 XP_004377085.1.4749 XP_004394702.1.74151 XP_004603576.1.94378 XP_004603577.1.94378 XP_004642949.1.9945 XP_004642950.1.9945 XP_004671312.1.11716 XP_004741069.1.14098 XP_005317752.1.77405 XP_005353189.1.66349 XP_005353190.1.66349 XP_005544278.1.63531 XP_005544279.1.63531 XP_006975645.1.50099 XP_007097966.1.5354 XP_007100940.1.24612 XP_007100941.1.24612 XP_007100942.1.24612 XP_007170601.1.59432 XP_007461872.1.90284 XP_007461873.1.90284 XP_007634564.1.28591 XP_007934019.1.48129 XP_007934020.1.48129 XP_007977949.1.81039 XP_007977950.1.81039 XP_008566901.1.73410 XP_008566903.1.73410 XP_008566904.1.73410 XP_008566905.1.73410 XP_008692733.1.72690 XP_008951663.1.60992 XP_008951664.1.60992 XP_008999008.1.60252 XP_008999009.1.60252 XP_008999010.1.60252 XP_009450295.1.37143 XP_010378637.1.97406 XP_010378638.1.97406 XP_010378640.1.97406 XP_010593438.1.64505 XP_010630494.1.5607 XP_010630498.1.5607 XP_010630507.1.5607 XP_011227546.1.58354 XP_011761414.1.29376 XP_011761415.1.29376 XP_011837127.1.47321 XP_011837128.1.47321 XP_011935239.1.92194 XP_011935240.1.92194 XP_012295274.1.9421 XP_012295275.1.9421 XP_012415866.1.74151 XP_012501433.1.63892 XP_012501434.1.63892 XP_012606013.1.48125 XP_013203923.1.66349 XP_013218621.1.77405 XP_014922471.1.86478 XP_014988574.1.72884 XP_014988578.1.72884 XP_015340882.1.40921 XP_015340883.1.40921 XP_015849954.1.50099 XP_017390250.1.71028 XP_017390251.1.71028 XP_017525205.1.32401 XP_017525206.1.32401 XP_017711951.1.44346 XP_017711952.1.44346 XP_018869358.1.27298 XP_019793859.1.83887 XP_019793860.1.83887 XP_020951337.1.46622 XP_020951338.1.46622 XP_021507084.1.76796 XP_021507085.1.76796 XP_513257.2.37143 ENSNLEP00000011977 ENSCAFP00000040836 ENSGGOP00000008371 9544.ENSMMUP00000007585 9598.ENSPTRP00000000760 9600.ENSPPYP00000001889 9615.ENSCAFP00000017254 ENSPTRP00000000760 ENSTTRP00000005236 ENSMMUP00000007585 ENSAMEP00000011991 ENSTTRP00000005236 ENSPCAP00000005112 ENSAMEP00000011991 ENSFCAP00000016431 ENSGGOP00000008371 ENSNLEP00000011977 ENSCJAP00000017863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]