SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000000936 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000000936
Domain Number 1 Region: 20-360
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 2.62e-69
Family ADP-ribosylglycohydrolase 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000000936   Gene: ENSPTRG00000000531   Transcript: ENSPTRT00000001039
Sequence length 364
Comment pep:known chromosome:CHIMP2.1.4:1:36293890:36298947:1 gene:ENSPTRG00000000531 transcript:ENSPTRT00000001039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAMAAAAGGGAGAARSLSRFRGCLAGALLGDCVGSFYEAHDTVDLTSVLRHVQSLEP
DPGTPGSERTEALYYTDDTAMARALVQSLLAKEAFDEVDMAHRFAQEYKKDPDRGYGAGV
VTVFKKLLNPKCRDVFEPARAQFNGKGSYGNGGAMRVAGISLAYSSVQDVQKFARLSAQL
THASSLGYNGAILQALAVHLALQGESSSEHFLKQLLGYMEDLEGDAQSVLDARELGMEER
PYSSRLKKIGELLDQASVTREEVVSELGNGIAAFESVPTAIYCFLRCMEPDPEIPSAFNS
LQRTLIYSISLGGDTDTIATMAGAIAGAYYGMDQVPESWQQSCEGYEETDILAQSLHRVF
QKSL
Download sequence
Identical sequences H2PYM9
ENSPTRP00000000936 XP_003812633.1.60992 XP_513315.2.37143 9598.ENSPTRP00000000936 ENSPTRP00000000936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]